BLASTX nr result
ID: Paeonia25_contig00009134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00009134 (481 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007200724.1| hypothetical protein PRUPE_ppa001025mg [Prun... 92 8e-17 ref|XP_004289675.1| PREDICTED: probable LRR receptor-like serine... 86 4e-15 ref|XP_006423267.1| hypothetical protein CICLE_v10027775mg [Citr... 84 2e-14 ref|XP_006423266.1| hypothetical protein CICLE_v10027775mg [Citr... 84 2e-14 ref|XP_002886213.1| hypothetical protein ARALYDRAFT_480795 [Arab... 83 3e-14 ref|XP_004148866.1| PREDICTED: probable LRR receptor-like serine... 83 5e-14 ref|XP_002313045.1| leucine-rich repeat transmembrane protein ki... 81 2e-13 ref|XP_006296940.1| hypothetical protein CARUB_v10012932mg [Caps... 79 5e-13 ref|XP_002306108.2| hypothetical protein POPTR_0004s16250g [Popu... 79 9e-13 ref|XP_004500811.1| PREDICTED: probable LRR receptor-like serine... 79 9e-13 ref|XP_003523518.1| PREDICTED: probable LRR receptor-like serine... 79 9e-13 ref|XP_003603924.1| Receptor kinase [Medicago truncatula] gi|355... 79 9e-13 ref|NP_179220.2| putative LRR receptor-like serine/threonine-pro... 78 1e-12 ref|XP_003527625.1| PREDICTED: probable LRR receptor-like serine... 78 1e-12 gb|AAD22312.1| putative LRR receptor protein kinase [Arabidopsis... 78 1e-12 ref|XP_007136169.1| hypothetical protein PHAVU_009G023800g [Phas... 77 3e-12 ref|NP_974713.1| leucine-rich repeat protein kinase-like protein... 76 6e-12 ref|NP_195638.1| leucine-rich repeat protein kinase-like protein... 76 6e-12 gb|AAM20702.1| receptor protein kinase-like protein [Arabidopsis... 76 6e-12 ref|XP_006409462.1| hypothetical protein EUTSA_v10023130mg, part... 75 7e-12 >ref|XP_007200724.1| hypothetical protein PRUPE_ppa001025mg [Prunus persica] gi|462396124|gb|EMJ01923.1| hypothetical protein PRUPE_ppa001025mg [Prunus persica] Length = 931 Score = 92.0 bits (227), Expect = 8e-17 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 +RDWPIKADPCL+W GIQCQNGRV+GINISGFRRTR+GSQNPQ Sbjct: 53 SRDWPIKADPCLIWRGIQCQNGRVVGINISGFRRTRLGSQNPQ 95 >ref|XP_004289675.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Fragaria vesca subsp. vesca] Length = 876 Score = 86.3 bits (212), Expect = 4e-15 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 +RDWPIK+DPCLVW G+ C NGRV+GINISGFRRTR+GSQNPQ Sbjct: 49 SRDWPIKSDPCLVWRGVGCSNGRVVGINISGFRRTRLGSQNPQ 91 >ref|XP_006423267.1| hypothetical protein CICLE_v10027775mg [Citrus clementina] gi|557525201|gb|ESR36507.1| hypothetical protein CICLE_v10027775mg [Citrus clementina] Length = 759 Score = 84.3 bits (207), Expect = 2e-14 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 356 RDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 RDWP K DPCLVWNG++CQNG V+GINISGFRRTR+GSQNP+ Sbjct: 66 RDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPR 107 >ref|XP_006423266.1| hypothetical protein CICLE_v10027775mg [Citrus clementina] gi|568867632|ref|XP_006487138.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like isoform X1 [Citrus sinensis] gi|568867634|ref|XP_006487139.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like isoform X2 [Citrus sinensis] gi|557525200|gb|ESR36506.1| hypothetical protein CICLE_v10027775mg [Citrus clementina] Length = 912 Score = 84.3 bits (207), Expect = 2e-14 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 356 RDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 RDWP K DPCLVWNG++CQNG V+GINISGFRRTR+GSQNP+ Sbjct: 66 RDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPR 107 >ref|XP_002886213.1| hypothetical protein ARALYDRAFT_480795 [Arabidopsis lyrata subsp. lyrata] gi|297332053|gb|EFH62472.1| hypothetical protein ARALYDRAFT_480795 [Arabidopsis lyrata subsp. lyrata] Length = 907 Score = 83.2 bits (204), Expect = 3e-14 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 359 DWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 DWPIK DPC+VW GIQC+NG +IGINISGFRRTRIG QNPQ Sbjct: 52 DWPIKGDPCVVWRGIQCENGSIIGINISGFRRTRIGKQNPQ 92 >ref|XP_004148866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Cucumis sativus] gi|449507355|ref|XP_004163008.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Cucumis sativus] Length = 896 Score = 82.8 bits (203), Expect = 5e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 ++DWPIKADPC VW GI+CQNGRV+GIN+SGFRRTR+GS +PQ Sbjct: 45 SKDWPIKADPCSVWRGIECQNGRVVGINVSGFRRTRLGSLHPQ 87 >ref|XP_002313045.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|222849453|gb|EEE87000.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 893 Score = 80.9 bits (198), Expect = 2e-13 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 +RDWPIKADPC +WNGI+C+NG V INISGF+RTR+GSQNPQ Sbjct: 51 SRDWPIKADPCSIWNGIKCENGSVSEINISGFKRTRLGSQNPQ 93 >ref|XP_006296940.1| hypothetical protein CARUB_v10012932mg [Capsella rubella] gi|565478602|ref|XP_006296941.1| hypothetical protein CARUB_v10012932mg [Capsella rubella] gi|482565649|gb|EOA29838.1| hypothetical protein CARUB_v10012932mg [Capsella rubella] gi|482565650|gb|EOA29839.1| hypothetical protein CARUB_v10012932mg [Capsella rubella] Length = 908 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +2 Query: 359 DWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 DWPIK DPC VW GIQC+NG + GINISGFRRTRIG QNPQ Sbjct: 50 DWPIKGDPCGVWRGIQCENGSITGINISGFRRTRIGKQNPQ 90 >ref|XP_002306108.2| hypothetical protein POPTR_0004s16250g [Populus trichocarpa] gi|550341148|gb|EEE86619.2| hypothetical protein POPTR_0004s16250g [Populus trichocarpa] Length = 906 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 ++DWP KADPC VWNGI+C+NG V INISGFRRTR+GSQNPQ Sbjct: 51 SKDWPRKADPCSVWNGIKCENGSVSEINISGFRRTRLGSQNPQ 93 >ref|XP_004500811.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Cicer arietinum] Length = 892 Score = 78.6 bits (192), Expect = 9e-13 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 +++WP K DPCL+W GI CQNGRV+GINISGFRRTRIG +NPQ Sbjct: 49 SKEWPRKPDPCLIWIGITCQNGRVVGINISGFRRTRIGRRNPQ 91 >ref|XP_003523518.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Glycine max] Length = 900 Score = 78.6 bits (192), Expect = 9e-13 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 +++WP K DPCL+W GI CQNGRV+GINISGFRRTRIG +NPQ Sbjct: 44 SKEWPRKPDPCLIWVGITCQNGRVVGINISGFRRTRIGRRNPQ 86 >ref|XP_003603924.1| Receptor kinase [Medicago truncatula] gi|355492972|gb|AES74175.1| Receptor kinase [Medicago truncatula] Length = 936 Score = 78.6 bits (192), Expect = 9e-13 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 +++WP K DPCL+W GI CQNGRV+GINISGFRRTRIG +NPQ Sbjct: 49 SKEWPRKPDPCLIWIGITCQNGRVVGINISGFRRTRIGRRNPQ 91 >ref|NP_179220.2| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] gi|264664473|sp|C0LGK4.1|Y2165_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At2g16250; Flags: Precursor gi|224589511|gb|ACN59289.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|330251384|gb|AEC06478.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] Length = 915 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 359 DWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 DWPIK DPC+ W GIQC+NG +IGINISGFRRTRIG NPQ Sbjct: 53 DWPIKGDPCVDWRGIQCENGSIIGINISGFRRTRIGKLNPQ 93 >ref|XP_003527625.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Glycine max] Length = 898 Score = 77.8 bits (190), Expect = 1e-12 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 +++WP K DPCL+W GI CQNGRV+GINISGFRRTR+G +NPQ Sbjct: 44 SKEWPRKPDPCLIWVGITCQNGRVVGINISGFRRTRLGRRNPQ 86 >gb|AAD22312.1| putative LRR receptor protein kinase [Arabidopsis thaliana] Length = 925 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 359 DWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 DWPIK DPC+ W GIQC+NG +IGINISGFRRTRIG NPQ Sbjct: 53 DWPIKGDPCVDWRGIQCENGSIIGINISGFRRTRIGKLNPQ 93 >ref|XP_007136169.1| hypothetical protein PHAVU_009G023800g [Phaseolus vulgaris] gi|561009256|gb|ESW08163.1| hypothetical protein PHAVU_009G023800g [Phaseolus vulgaris] Length = 904 Score = 76.6 bits (187), Expect = 3e-12 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQCQNGRVIGINISGFRRTRIGSQNPQ 481 +++WP K DPCL+W GI CQNGRV+GINISGF+RTRIG +NPQ Sbjct: 45 SKEWPRKPDPCLLWVGITCQNGRVVGINISGFKRTRIGRRNPQ 87 >ref|NP_974713.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] gi|332661648|gb|AEE87048.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] Length = 694 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQC-QNGRVIGINISGFRRTRIGSQNPQ 481 +RDWP+K +PCL WNGI+C QNGRV INISGFRRTRIG+QNP+ Sbjct: 48 SRDWPVKGNPCLNWNGIKCDQNGRVTKINISGFRRTRIGNQNPE 91 >ref|NP_195638.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] gi|4914439|emb|CAB43642.1| receptor protein kinase-like protein [Arabidopsis thaliana] gi|7270910|emb|CAB80590.1| receptor protein kinase-like protein [Arabidopsis thaliana] gi|332661649|gb|AEE87049.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] Length = 864 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQC-QNGRVIGINISGFRRTRIGSQNPQ 481 +RDWP+K +PCL WNGI+C QNGRV INISGFRRTRIG+QNP+ Sbjct: 48 SRDWPVKGNPCLNWNGIKCDQNGRVTKINISGFRRTRIGNQNPE 91 >gb|AAM20702.1| receptor protein kinase-like protein [Arabidopsis thaliana] Length = 864 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = +2 Query: 353 ARDWPIKADPCLVWNGIQC-QNGRVIGINISGFRRTRIGSQNPQ 481 +RDWP+K +PCL WNGI+C QNGRV INISGFRRTRIG+QNP+ Sbjct: 48 SRDWPVKGNPCLNWNGIKCDQNGRVTKINISGFRRTRIGNQNPE 91 >ref|XP_006409462.1| hypothetical protein EUTSA_v10023130mg, partial [Eutrema salsugineum] gi|557110624|gb|ESQ50915.1| hypothetical protein EUTSA_v10023130mg, partial [Eutrema salsugineum] Length = 901 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +2 Query: 359 DWPIKADPCLVWNGIQCQ-NGRVIGINISGFRRTRIGSQNPQ 481 DWPIK DPC VW GIQC NG ++GINISGFRRTRIG QNPQ Sbjct: 55 DWPIKGDPCGVWKGIQCDGNGSIVGINISGFRRTRIGKQNPQ 96