BLASTX nr result
ID: Paeonia25_contig00008264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00008264 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300861.2| hypothetical protein POPTR_0002s05700g [Popu... 62 6e-08 ref|XP_002307567.2| hypothetical protein POPTR_0005s22800g [Popu... 57 2e-06 ref|XP_002530627.1| TMV resistance protein N, putative [Ricinus ... 57 3e-06 ref|XP_006367171.1| PREDICTED: TMV resistance protein N-like [So... 55 1e-05 >ref|XP_002300861.2| hypothetical protein POPTR_0002s05700g [Populus trichocarpa] gi|550344355|gb|EEE80134.2| hypothetical protein POPTR_0002s05700g [Populus trichocarpa] Length = 979 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/56 (48%), Positives = 38/56 (67%) Frame = +2 Query: 158 ISYYNLVDDMLPDDIQRLPYLKVLNICGNNFSKLSADISHLPQLQNLYFNECQRLE 325 + + NL DDM+P D+Q LP L+ L +C NNF+ L A I LP+L L+ NEC+ L+ Sbjct: 578 LGHCNLTDDMIPSDLQGLPLLQNLKLCRNNFTSLPASIGSLPKLTRLWLNECKSLQ 633 >ref|XP_002307567.2| hypothetical protein POPTR_0005s22800g [Populus trichocarpa] gi|550339559|gb|EEE94563.2| hypothetical protein POPTR_0005s22800g [Populus trichocarpa] Length = 915 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/56 (46%), Positives = 36/56 (64%) Frame = +2 Query: 158 ISYYNLVDDMLPDDIQRLPYLKVLNICGNNFSKLSADISHLPQLQNLYFNECQRLE 325 + + NL D M+P D + L L+ L +CGNNF+ L A I +LP+L L N C+RLE Sbjct: 556 LRHCNLSDSMIPHDFRGLFLLQTLKLCGNNFTSLPASIGNLPKLTKLLLNNCKRLE 611 >ref|XP_002530627.1| TMV resistance protein N, putative [Ricinus communis] gi|223529837|gb|EEF31770.1| TMV resistance protein N, putative [Ricinus communis] Length = 1116 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/59 (42%), Positives = 37/59 (62%) Frame = +2 Query: 149 SRHISYYNLVDDMLPDDIQRLPYLKVLNICGNNFSKLSADISHLPQLQNLYFNECQRLE 325 S ++SY NL D LP D+ P LK N+ GNNF + + IS L +L++ F+ C+RL+ Sbjct: 719 SLNLSYCNLTDGALPSDLSCFPLLKTFNLSGNNFVSIPSSISRLSKLEDFQFSNCKRLQ 777 >ref|XP_006367171.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum] Length = 1188 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = +2 Query: 158 ISYYNLVDDMLPDDIQRLPYLKVLNICGNNFSKLSADISHLPQLQNLYFNECQRL 322 +SY N++D+ LP+DI L LK L +CGNNF L IS L L+ L+ + C+RL Sbjct: 829 LSYCNIIDEGLPEDIGSLSSLKELYLCGNNFEHLPQSISKLGALEYLHLSHCKRL 883