BLASTX nr result
ID: Paeonia25_contig00008168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00008168 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605689.1| hypothetical protein MTR_4g036430 [Medicago ... 60 3e-07 >ref|XP_003605689.1| hypothetical protein MTR_4g036430 [Medicago truncatula] gi|355506744|gb|AES87886.1| hypothetical protein MTR_4g036430 [Medicago truncatula] Length = 69 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +3 Query: 276 GSMALEEGKIRIEKFDGSDFGYWKMQIEDFLRSKKLHKTL 395 G +A +EGK++IEKFD +FG+WKMQIED+L KKLH+ L Sbjct: 29 GVIAADEGKVKIEKFDDGNFGFWKMQIEDYLYQKKLHQPL 68