BLASTX nr result
ID: Paeonia25_contig00008011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00008011 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004500254.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 87 3e-15 gb|AFK34845.1| unknown [Medicago truncatula] 87 3e-15 ref|XP_006488528.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 86 4e-15 ref|XP_006425067.1| hypothetical protein CICLE_v10029291mg [Citr... 86 4e-15 gb|EPS66571.1| peptidyl-prolyl cis-trans isomerase, partial [Gen... 86 4e-15 gb|AEK80448.1| peptidyl-prolyl cis-trans isomerase [Carica papaya] 86 4e-15 gb|ABS30424.1| cyclophilin-like protein [Nicotiana tabacum] 86 4e-15 ref|XP_004143158.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 86 5e-15 gb|AFN53672.1| peptidyl-prolyl cis-trans isomerase [Linum usitat... 86 5e-15 gb|AFK44786.1| unknown [Lotus japonicus] 86 5e-15 gb|AFK38976.1| unknown [Lotus japonicus] 86 5e-15 ref|XP_007146769.1| hypothetical protein PHAVU_006G068200g [Phas... 86 7e-15 ref|XP_007205916.1| hypothetical protein PRUPE_ppa011595mg [Prun... 86 7e-15 ref|NP_001236075.1| uncharacterized protein LOC100305485 precurs... 86 7e-15 ref|XP_002525647.1| cyclophilin, putative [Ricinus communis] gi|... 86 7e-15 emb|CAP69837.1| cyclophilin [Ricinus communis] 86 7e-15 ref|XP_006848226.1| hypothetical protein AMTR_s00029p00245680 [A... 85 9e-15 ref|XP_003563538.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 85 9e-15 emb|CBI15954.3| unnamed protein product [Vitis vinifera] 85 9e-15 ref|XP_002313378.1| peptidyl-prolyl cis-trans isomerase family p... 85 9e-15 >ref|XP_004500254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Cicer arietinum] Length = 204 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKVVIADSGELP Sbjct: 160 LDGRHVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELP 203 >gb|AFK34845.1| unknown [Medicago truncatula] Length = 203 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKVVIADSGELP Sbjct: 159 LDGRHVVFGKVLSGMDVVYKIEAEGNQSGTPKSKVVIADSGELP 202 >ref|XP_006488528.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Citrus sinensis] Length = 207 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYKVEAEG Q+GTPKSKVVIADSGELP Sbjct: 163 LDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSKVVIADSGELP 206 >ref|XP_006425067.1| hypothetical protein CICLE_v10029291mg [Citrus clementina] gi|557527001|gb|ESR38307.1| hypothetical protein CICLE_v10029291mg [Citrus clementina] Length = 207 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYKVEAEG Q+GTPKSKVVIADSGELP Sbjct: 163 LDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSKVVIADSGELP 206 >gb|EPS66571.1| peptidyl-prolyl cis-trans isomerase, partial [Genlisea aurea] Length = 184 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKV+SGMDVVYK+EAEG QSGTPKSKVVIADSGELP Sbjct: 140 LDGRHVVFGKVISGMDVVYKIEAEGKQSGTPKSKVVIADSGELP 183 >gb|AEK80448.1| peptidyl-prolyl cis-trans isomerase [Carica papaya] Length = 208 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKV+SGMDVVYKVEAEG QSGTPKSKVVIADSGELP Sbjct: 164 LDGRHVVFGKVVSGMDVVYKVEAEGRQSGTPKSKVVIADSGELP 207 >gb|ABS30424.1| cyclophilin-like protein [Nicotiana tabacum] Length = 207 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKVVIADSGELP Sbjct: 163 LDGRHVVFGKVLSGMDVVYKIEAEGGQSGTPKSKVVIADSGELP 206 >ref|XP_004143158.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Cucumis sativus] gi|449496575|ref|XP_004160169.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Cucumis sativus] Length = 204 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYK+EAEG Q+GTPKSKVVIADSGELP Sbjct: 160 LDGRHVVFGKVLSGMDVVYKIEAEGRQNGTPKSKVVIADSGELP 203 >gb|AFN53672.1| peptidyl-prolyl cis-trans isomerase [Linum usitatissimum] Length = 206 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYKVEAEG QSGTPKSKVVI DSGELP Sbjct: 162 LDGRHVVFGKVLSGMDVVYKVEAEGKQSGTPKSKVVIVDSGELP 205 >gb|AFK44786.1| unknown [Lotus japonicus] Length = 204 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKVVIADSGELP Sbjct: 160 LDGRHVVFGKVLSGMDVVYKMEAEGNQSGTPKSKVVIADSGELP 203 >gb|AFK38976.1| unknown [Lotus japonicus] Length = 204 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKVVIADSGELP Sbjct: 160 LDGRHVVFGKVLSGMDVVYKMEAEGNQSGTPKSKVVIADSGELP 203 >ref|XP_007146769.1| hypothetical protein PHAVU_006G068200g [Phaseolus vulgaris] gi|561019992|gb|ESW18763.1| hypothetical protein PHAVU_006G068200g [Phaseolus vulgaris] Length = 204 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDG+HVVFGKV+SGMDVVYKVEAEG QSGTPKSKVVIADSGELP Sbjct: 160 LDGKHVVFGKVISGMDVVYKVEAEGRQSGTPKSKVVIADSGELP 203 >ref|XP_007205916.1| hypothetical protein PRUPE_ppa011595mg [Prunus persica] gi|462401558|gb|EMJ07115.1| hypothetical protein PRUPE_ppa011595mg [Prunus persica] Length = 204 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYK+EAEG Q+GTPKSKVVIADSGELP Sbjct: 160 LDGRHVVFGKVLSGMDVVYKIEAEGNQNGTPKSKVVIADSGELP 203 >ref|NP_001236075.1| uncharacterized protein LOC100305485 precursor [Glycine max] gi|255625651|gb|ACU13170.1| unknown [Glycine max] Length = 204 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKVVI DSGELP Sbjct: 160 LDGRHVVFGKVLSGMDVVYKIEAEGTQSGTPKSKVVIVDSGELP 203 >ref|XP_002525647.1| cyclophilin, putative [Ricinus communis] gi|223535083|gb|EEF36765.1| cyclophilin, putative [Ricinus communis] Length = 204 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV IADSGELP Sbjct: 160 LDGRHVVFGKVLSGMDVVYKIEAEGRQSGTPKSKVTIADSGELP 203 >emb|CAP69837.1| cyclophilin [Ricinus communis] Length = 133 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYK+EAEG QSGTPKSKV IADSGELP Sbjct: 89 LDGRHVVFGKVLSGMDVVYKIEAEGRQSGTPKSKVTIADSGELP 132 >ref|XP_006848226.1| hypothetical protein AMTR_s00029p00245680 [Amborella trichopoda] gi|548851531|gb|ERN09807.1| hypothetical protein AMTR_s00029p00245680 [Amborella trichopoda] Length = 207 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDG+HVVFGKV+SGMDVVYK+EAEG QSGTPKSKVVIADSGELP Sbjct: 163 LDGKHVVFGKVISGMDVVYKIEAEGRQSGTPKSKVVIADSGELP 206 >ref|XP_003563538.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Brachypodium distachyon] Length = 220 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDG+HVVFGKVLSGMDV+YKVEAEG Q+GTPKSKVVIADSGELP Sbjct: 176 LDGKHVVFGKVLSGMDVIYKVEAEGQQTGTPKSKVVIADSGELP 219 >emb|CBI15954.3| unnamed protein product [Vitis vinifera] Length = 200 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKVLSGMDVVYK+EAEG QSGTPK+KVVIADSGELP Sbjct: 156 LDGRHVVFGKVLSGMDVVYKMEAEGRQSGTPKTKVVIADSGELP 199 >ref|XP_002313378.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa] gi|118483106|gb|ABK93462.1| unknown [Populus trichocarpa] gi|118483497|gb|ABK93647.1| unknown [Populus trichocarpa] gi|118488634|gb|ABK96129.1| unknown [Populus trichocarpa] gi|222849786|gb|EEE87333.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa] Length = 207 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 249 LDGRHVVFGKVLSGMDVVYKVEAEGMQSGTPKSKVVIADSGELP 118 LDGRHVVFGKV+SGMDVVYKVEAEG Q+GTPKSKVV+ADSGELP Sbjct: 163 LDGRHVVFGKVISGMDVVYKVEAEGRQNGTPKSKVVVADSGELP 206