BLASTX nr result
ID: Paeonia25_contig00007910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00007910 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298040.2| glutathione S-transferase family protein [Po... 66 4e-09 gb|ADB11337.1| theta class glutathione transferase GSTT1 [Populu... 66 4e-09 ref|XP_002509785.1| glutathione-s-transferase theta, gst, putati... 62 1e-07 ref|XP_006439582.1| hypothetical protein CICLE_v10021879mg [Citr... 60 2e-07 ref|XP_004298759.1| PREDICTED: glutathione S-transferase T1-like... 60 4e-07 gb|ADB11338.1| theta class glutathione transferase GSTT2 [Populu... 57 3e-06 ref|XP_002304489.1| glutathione S-transferase family protein [Po... 57 3e-06 >ref|XP_002298040.2| glutathione S-transferase family protein [Populus trichocarpa] gi|550346875|gb|EEE82845.2| glutathione S-transferase family protein [Populus trichocarpa] Length = 247 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -3 Query: 237 WIEDTKNATGPHFDEVHQVLFKAKVLLQKQRSNGGNSETTST 112 W+EDTKNAT PHFDEVHQ+LFKAKV LQK RS NSE T Sbjct: 200 WMEDTKNATRPHFDEVHQILFKAKVKLQKVRSMSTNSENLKT 241 >gb|ADB11337.1| theta class glutathione transferase GSTT1 [Populus trichocarpa] Length = 247 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -3 Query: 237 WIEDTKNATGPHFDEVHQVLFKAKVLLQKQRSNGGNSETTST 112 W+EDTKNAT PHFDEVHQ+LFKAKV LQK RS NSE T Sbjct: 200 WMEDTKNATRPHFDEVHQILFKAKVKLQKVRSMSTNSENLKT 241 >ref|XP_002509785.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] gi|223549684|gb|EEF51172.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] Length = 250 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -3 Query: 237 WIEDTKNATGPHFDEVHQVLFKAKVLLQKQRSNGGNSETTST*K 106 WIED K T PHFDEVH+VLF+AK LQKQ+S G N ET S K Sbjct: 200 WIEDIKRVTRPHFDEVHKVLFRAKARLQKQQSVGANGETESNLK 243 >ref|XP_006439582.1| hypothetical protein CICLE_v10021879mg [Citrus clementina] gi|568845464|ref|XP_006476593.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis] gi|557541844|gb|ESR52822.1| hypothetical protein CICLE_v10021879mg [Citrus clementina] Length = 247 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 237 WIEDTKNATGPHFDEVHQVLFKAKVLLQKQRSNGGNSETTST 112 WIE TKNAT PHFDEVH+VLFK K LQKQ+S G +S ++S+ Sbjct: 200 WIESTKNATRPHFDEVHEVLFKVKENLQKQQSLGASSGSSSS 241 >ref|XP_004298759.1| PREDICTED: glutathione S-transferase T1-like [Fragaria vesca subsp. vesca] Length = 252 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -3 Query: 237 WIEDTKNATGPHFDEVHQVLFKAKVLLQKQRSNGGNSETTS 115 WIE+TKNAT PHF+EVHQ+L++AK Q+QRS G N+ +S Sbjct: 200 WIENTKNATRPHFEEVHQILYRAKTRFQEQRSMGANNTNSS 240 >gb|ADB11338.1| theta class glutathione transferase GSTT2 [Populus trichocarpa] Length = 232 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 237 WIEDTKNATGPHFDEVHQVLFKAKVLLQKQR 145 WIEDTKNAT PHFDEVHQ LF AKV LQ QR Sbjct: 201 WIEDTKNATKPHFDEVHQALFAAKVKLQMQR 231 >ref|XP_002304489.1| glutathione S-transferase family protein [Populus trichocarpa] gi|222841921|gb|EEE79468.1| glutathione S-transferase family protein [Populus trichocarpa] Length = 232 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 237 WIEDTKNATGPHFDEVHQVLFKAKVLLQKQR 145 WIEDTKNAT PHFDEVHQ LF AKV LQ QR Sbjct: 201 WIEDTKNATKPHFDEVHQALFAAKVKLQMQR 231