BLASTX nr result
ID: Paeonia25_contig00004661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00004661 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADR65113.1| mevalonate 5-diphosphate decarboxylase [Catharant... 81 2e-13 gb|EXB36970.1| Diphosphomevalonate decarboxylase [Morus notabilis] 78 1e-12 gb|ABV02028.1| mevalonate diphosphate decarboxylase [Nicotiana l... 76 4e-12 dbj|BAF98285.1| diphosphomevelonate decarboxylase [Hevea brasili... 76 6e-12 ref|XP_004236810.1| PREDICTED: diphosphomevalonate decarboxylase... 75 7e-12 gb|AFS28685.1| putative phosphomevalonate kinase, partial [Olea ... 75 7e-12 ref|XP_003536712.1| PREDICTED: diphosphomevalonate decarboxylase... 75 9e-12 ref|XP_004497159.1| PREDICTED: diphosphomevalonate decarboxylase... 75 1e-11 ref|XP_007211744.1| hypothetical protein PRUPE_ppa006290mg [Prun... 75 1e-11 ref|XP_002315441.1| mevalonate disphosphate decarboxylase family... 74 2e-11 gb|AAL18927.1|AF429386_1 mevalonate disphosphate decarboxylase [... 74 2e-11 gb|AFK38744.1| unknown [Medicago truncatula] 74 2e-11 ref|XP_003555870.1| PREDICTED: diphosphomevalonate decarboxylase... 74 2e-11 ref|XP_002521172.1| diphosphomevalonate decarboxylase, putative ... 74 2e-11 ref|XP_002311015.1| mevalonate disphosphate decarboxylase family... 73 5e-11 ref|XP_002266399.1| PREDICTED: diphosphomevalonate decarboxylase... 72 6e-11 ref|XP_007142839.1| hypothetical protein PHAVU_007G021200g [Phas... 72 8e-11 gb|AGZ15316.1| mevalonate decarboxylase [Platycodon grandiflorus] 72 1e-10 ref|XP_006359351.1| PREDICTED: diphosphomevalonate decarboxylase... 71 1e-10 gb|AGT17596.1| mevalonate diphosphate decarboxylase [Picrorhiza ... 71 2e-10 >gb|ADR65113.1| mevalonate 5-diphosphate decarboxylase [Catharanthus roseus] Length = 421 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 PA KYKGDVSYFICT+PGRGPVLL++ESQSLLNPETGLPK Sbjct: 382 PAQKYKGDVSYFICTRPGRGPVLLTEESQSLLNPETGLPK 421 >gb|EXB36970.1| Diphosphomevalonate decarboxylase [Morus notabilis] Length = 400 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 P+ KY+GDVSYFICT+PGRGPV LSDESQ+LLNPETGLPK Sbjct: 361 PSQKYRGDVSYFICTRPGRGPVYLSDESQALLNPETGLPK 400 >gb|ABV02028.1| mevalonate diphosphate decarboxylase [Nicotiana langsdorffii x Nicotiana sanderae] Length = 406 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 PA KYKG++SYFICT+PGRGPVLL+D+S +LLNPETGLPK Sbjct: 367 PAQKYKGEISYFICTRPGRGPVLLTDDSHALLNPETGLPK 406 >dbj|BAF98285.1| diphosphomevelonate decarboxylase [Hevea brasiliensis] Length = 415 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -3 Query: 276 AHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 A +YKGDVSYFICT+PGRGPVLLSDESQ+LL+PETGLPK Sbjct: 377 APRYKGDVSYFICTRPGRGPVLLSDESQALLSPETGLPK 415 >ref|XP_004236810.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum lycopersicum] Length = 421 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/40 (77%), Positives = 39/40 (97%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 PA KYKG++SYFICT+PGRGPVL+SD+SQ+LL+P+TGLPK Sbjct: 382 PAQKYKGEISYFICTRPGRGPVLISDDSQALLHPDTGLPK 421 >gb|AFS28685.1| putative phosphomevalonate kinase, partial [Olea europaea] Length = 40 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 P KYKGDVSYFICTKPGRGPVLL++ESQ+LL+P+TGLPK Sbjct: 1 PTQKYKGDVSYFICTKPGRGPVLLTNESQALLDPKTGLPK 40 >ref|XP_003536712.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max] Length = 420 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 P KYKGDVSYFICT+PGRGPVLLSD SQ+LLN ETGLPK Sbjct: 381 PPQKYKGDVSYFICTRPGRGPVLLSDSSQALLNGETGLPK 420 >ref|XP_004497159.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cicer arietinum] Length = 421 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 P+ KYKG+VSYFICT+PGRGPVLLSDESQ+LLN E GLPK Sbjct: 382 PSQKYKGEVSYFICTRPGRGPVLLSDESQALLNSENGLPK 421 >ref|XP_007211744.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica] gi|462407609|gb|EMJ12943.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica] Length = 419 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 P+ +++GDVSYFICT+PGRGPV+LSDESQ LLNPETGLPK Sbjct: 380 PSQRHRGDVSYFICTRPGRGPVVLSDESQFLLNPETGLPK 419 >ref|XP_002315441.1| mevalonate disphosphate decarboxylase family protein [Populus trichocarpa] gi|222864481|gb|EEF01612.1| mevalonate disphosphate decarboxylase family protein [Populus trichocarpa] Length = 416 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -3 Query: 276 AHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 A + KGDVSYFICTKPGRGPVLLSDESQ+LL+PETGLPK Sbjct: 378 AQRSKGDVSYFICTKPGRGPVLLSDESQALLHPETGLPK 416 >gb|AAL18927.1|AF429386_1 mevalonate disphosphate decarboxylase [Hevea brasiliensis] Length = 415 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -3 Query: 276 AHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 A +YKGDVSYFICT+PG+GPVLLSDESQ+LL+PETGLPK Sbjct: 377 APRYKGDVSYFICTRPGQGPVLLSDESQALLSPETGLPK 415 >gb|AFK38744.1| unknown [Medicago truncatula] Length = 191 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 P+ KYKGDVSYFICT+PGRGPV+L+DESQ+LLN E GLPK Sbjct: 152 PSQKYKGDVSYFICTRPGRGPVVLTDESQALLNSENGLPK 191 >ref|XP_003555870.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max] Length = 421 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 P+ KYKGDVSYFICT+PGRGPVLLSD Q+LLN ETGLPK Sbjct: 382 PSQKYKGDVSYFICTRPGRGPVLLSDSIQALLNDETGLPK 421 >ref|XP_002521172.1| diphosphomevalonate decarboxylase, putative [Ricinus communis] gi|223539619|gb|EEF41203.1| diphosphomevalonate decarboxylase, putative [Ricinus communis] Length = 415 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = -3 Query: 276 AHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 A ++KGDVSYFICT+PGRGPVLL+DESQ+LLNP+TGLPK Sbjct: 377 APRFKGDVSYFICTRPGRGPVLLTDESQALLNPQTGLPK 415 >ref|XP_002311015.1| mevalonate disphosphate decarboxylase family protein [Populus trichocarpa] gi|222850835|gb|EEE88382.1| mevalonate disphosphate decarboxylase family protein [Populus trichocarpa] Length = 416 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 276 AHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 A + KGDVSYFICTKPGRGP LLSDESQ+LL+PETGLPK Sbjct: 378 AQRCKGDVSYFICTKPGRGPALLSDESQALLHPETGLPK 416 >ref|XP_002266399.1| PREDICTED: diphosphomevalonate decarboxylase [Vitis vinifera] gi|296087980|emb|CBI35263.3| unnamed protein product [Vitis vinifera] Length = 422 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 PA K +G VSYFICT+PG+GPVLLSDESQ+LLNPE+GLPK Sbjct: 383 PAQKQRGAVSYFICTRPGKGPVLLSDESQALLNPESGLPK 422 >ref|XP_007142839.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris] gi|561016029|gb|ESW14833.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris] Length = 420 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 P+ KY+GD+SYFICT+PGRGPVLLSD S +LLN ETGLPK Sbjct: 381 PSQKYRGDISYFICTRPGRGPVLLSDSSLALLNDETGLPK 420 >gb|AGZ15316.1| mevalonate decarboxylase [Platycodon grandiflorus] Length = 417 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 P K KGDVSYFICT+PGRGPV+LSDESQ+LL+P TGLPK Sbjct: 378 PTQKSKGDVSYFICTRPGRGPVVLSDESQALLDPVTGLPK 417 >ref|XP_006359351.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum] Length = 429 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/40 (72%), Positives = 38/40 (95%) Frame = -3 Query: 279 PAHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 PA KYKG++SYFICT+PGRGPVL+S +SQ+LL+P++GLPK Sbjct: 390 PAQKYKGEISYFICTRPGRGPVLISGDSQALLHPDSGLPK 429 >gb|AGT17596.1| mevalonate diphosphate decarboxylase [Picrorhiza kurrooa] Length = 421 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -3 Query: 276 AHKYKGDVSYFICTKPGRGPVLLSDESQSLLNPETGLPK 160 A KY+GDVSYFICTKPGRGP +++DES+SL+NPE GLPK Sbjct: 383 AQKYRGDVSYFICTKPGRGPAVVNDESRSLINPEFGLPK 421