BLASTX nr result
ID: Paeonia25_contig00004506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00004506 (578 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007010212.1| Cytochrome P450 isoform 2 [Theobroma cacao] ... 59 9e-07 ref|XP_007010211.1| Cytochrome P450 isoform 1 [Theobroma cacao] ... 59 9e-07 >ref|XP_007010212.1| Cytochrome P450 isoform 2 [Theobroma cacao] gi|508727125|gb|EOY19022.1| Cytochrome P450 isoform 2 [Theobroma cacao] Length = 347 Score = 58.9 bits (141), Expect = 9e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 Query: 3 KFGDIHVPKGVSVWTMIIALHQDVDNWGPD 92 KFGDIHVPKGVS+WT+++ LHQD + WGPD Sbjct: 233 KFGDIHVPKGVSIWTLVVTLHQDPNIWGPD 262 >ref|XP_007010211.1| Cytochrome P450 isoform 1 [Theobroma cacao] gi|508727124|gb|EOY19021.1| Cytochrome P450 isoform 1 [Theobroma cacao] Length = 516 Score = 58.9 bits (141), Expect = 9e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 Query: 3 KFGDIHVPKGVSVWTMIIALHQDVDNWGPD 92 KFGDIHVPKGVS+WT+++ LHQD + WGPD Sbjct: 402 KFGDIHVPKGVSIWTLVVTLHQDPNIWGPD 431