BLASTX nr result
ID: Paeonia25_contig00003833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00003833 (526 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006285372.1| hypothetical protein CARUB_v10006763mg [Caps... 52 5e-08 ref|XP_002868069.1| hypothetical protein ARALYDRAFT_493135 [Arab... 52 6e-08 ref|NP_193473.1| O-fucosyltransferase family protein [Arabidopsi... 52 8e-08 emb|CAB10524.1| hypothetical protein [Arabidopsis thaliana] gi|7... 52 8e-08 ref|XP_006414231.1| hypothetical protein EUTSA_v10024957mg [Eutr... 48 8e-07 ref|XP_004152423.1| PREDICTED: uncharacterized protein LOC101209... 49 8e-07 emb|CBI29499.3| unnamed protein product [Vitis vinifera] 48 8e-07 ref|XP_002272057.2| PREDICTED: uncharacterized protein LOC100266... 48 8e-07 ref|XP_007039776.1| O-fucosyltransferase family protein isoform ... 49 1e-06 ref|XP_007039777.1| O-fucosyltransferase family protein, putativ... 49 1e-06 gb|EXC02106.1| hypothetical protein L484_024071 [Morus notabilis] 47 1e-06 ref|XP_002521236.1| conserved hypothetical protein [Ricinus comm... 45 2e-06 ref|XP_006477145.1| PREDICTED: uncharacterized protein LOC102619... 49 2e-06 ref|XP_006440263.1| hypothetical protein CICLE_v10019844mg [Citr... 49 2e-06 ref|XP_004503386.1| PREDICTED: uncharacterized protein LOC101504... 51 3e-06 gb|ABD65093.1| hypothetical protein 31.t00055 [Brassica oleracea] 46 4e-06 ref|XP_003630908.1| CigA protein [Medicago truncatula] gi|355524... 50 4e-06 ref|XP_006355417.1| PREDICTED: uncharacterized protein LOC102586... 48 7e-06 >ref|XP_006285372.1| hypothetical protein CARUB_v10006763mg [Capsella rubella] gi|482554077|gb|EOA18270.1| hypothetical protein CARUB_v10006763mg [Capsella rubella] Length = 507 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 23/50 (46%), Positives = 37/50 (74%) Frame = -3 Query: 473 IFTNLQQIHKYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 ++ ++ + K P I++++FLP V +M AGK++ S+TIKA FLCA+LRL Sbjct: 307 LYIDILKSSKIKPLIEKVDFLPFVQEIMRAGKKFASETIKAPFLCAQLRL 356 Score = 30.4 bits (67), Expect(2) = 5e-08 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK SELYI Sbjct: 295 GSLFTAPYKGSELYI 309 >ref|XP_002868069.1| hypothetical protein ARALYDRAFT_493135 [Arabidopsis lyrata subsp. lyrata] gi|297313905|gb|EFH44328.1| hypothetical protein ARALYDRAFT_493135 [Arabidopsis lyrata subsp. lyrata] Length = 508 Score = 52.0 bits (123), Expect(2) = 6e-08 Identities = 22/50 (44%), Positives = 37/50 (74%) Frame = -3 Query: 473 IFTNLQQIHKYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 ++ ++ + K P +++++FLP V +M AGK++ S+TIKA FLCA+LRL Sbjct: 307 LYIDIHKSPKIKPLVEKVDFLPFVREIMRAGKKFASETIKAPFLCAQLRL 356 Score = 30.4 bits (67), Expect(2) = 6e-08 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK SELYI Sbjct: 295 GSLFTAPYKGSELYI 309 >ref|NP_193473.1| O-fucosyltransferase family protein [Arabidopsis thaliana] gi|95147298|gb|ABF57284.1| At4g17430 [Arabidopsis thaliana] gi|332658490|gb|AEE83890.1| O-fucosyltransferase family protein [Arabidopsis thaliana] Length = 507 Score = 51.6 bits (122), Expect(2) = 8e-08 Identities = 22/50 (44%), Positives = 37/50 (74%) Frame = -3 Query: 473 IFTNLQQIHKYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 ++ ++ + K +++++FLP V +MIAGK++ S+TIKA FLCA+LRL Sbjct: 306 LYIDIHKSPKIKSLVEKVDFLPFVREIMIAGKKFASETIKAPFLCAQLRL 355 Score = 30.4 bits (67), Expect(2) = 8e-08 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK SELYI Sbjct: 294 GSLFTAPYKGSELYI 308 >emb|CAB10524.1| hypothetical protein [Arabidopsis thaliana] gi|7268495|emb|CAB78746.1| hypothetical protein [Arabidopsis thaliana] Length = 478 Score = 51.6 bits (122), Expect(2) = 8e-08 Identities = 22/50 (44%), Positives = 37/50 (74%) Frame = -3 Query: 473 IFTNLQQIHKYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 ++ ++ + K +++++FLP V +MIAGK++ S+TIKA FLCA+LRL Sbjct: 277 LYIDIHKSPKIKSLVEKVDFLPFVREIMIAGKKFASETIKAPFLCAQLRL 326 Score = 30.4 bits (67), Expect(2) = 8e-08 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK SELYI Sbjct: 265 GSLFTAPYKGSELYI 279 >ref|XP_006414231.1| hypothetical protein EUTSA_v10024957mg [Eutrema salsugineum] gi|557115401|gb|ESQ55684.1| hypothetical protein EUTSA_v10024957mg [Eutrema salsugineum] Length = 509 Score = 48.1 bits (113), Expect(2) = 8e-07 Identities = 22/49 (44%), Positives = 33/49 (67%) Frame = -3 Query: 470 FTNLQQIHKYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 F + + IK+++FLP V +M AGK++ S+TIKA F+CA+LRL Sbjct: 310 FHKSSSVPEIKSLIKKVDFLPFVREIMSAGKKFASETIKAPFVCAQLRL 358 Score = 30.4 bits (67), Expect(2) = 8e-07 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK SELYI Sbjct: 294 GSLFTAPYKGSELYI 308 >ref|XP_004152423.1| PREDICTED: uncharacterized protein LOC101209896 [Cucumis sativus] gi|449488756|ref|XP_004158162.1| PREDICTED: uncharacterized protein LOC101225143 [Cucumis sativus] Length = 494 Score = 49.3 bits (116), Expect(2) = 8e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -3 Query: 446 KYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 + + +K IE+LP VP ++ AGKEY K IKA FLCA+LRL Sbjct: 305 RISSLMKNIEYLPFVPEILSAGKEYIDKIIKAPFLCAQLRL 345 Score = 29.3 bits (64), Expect(2) = 8e-07 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PY+ SELYI Sbjct: 281 GSLFTAPYRGSELYI 295 >emb|CBI29499.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 48.1 bits (113), Expect(2) = 8e-07 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = -3 Query: 446 KYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 + + I++IEFLP VP++ A KEY +TIK FLCA+LRL Sbjct: 299 RISSLIQKIEFLPFVPLITSAAKEYAIETIKGPFLCAQLRL 339 Score = 30.4 bits (67), Expect(2) = 8e-07 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK SELYI Sbjct: 275 GSLFTAPYKGSELYI 289 >ref|XP_002272057.2| PREDICTED: uncharacterized protein LOC100266043 [Vitis vinifera] Length = 482 Score = 48.1 bits (113), Expect(2) = 8e-07 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = -3 Query: 446 KYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 + + I++IEFLP VP++ A KEY +TIK FLCA+LRL Sbjct: 299 RISSLIQKIEFLPFVPLITSAAKEYAIETIKGPFLCAQLRL 339 Score = 30.4 bits (67), Expect(2) = 8e-07 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK SELYI Sbjct: 275 GSLFTAPYKGSELYI 289 >ref|XP_007039776.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao] gi|508777021|gb|EOY24277.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao] Length = 577 Score = 48.9 bits (115), Expect(2) = 1e-06 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = -3 Query: 446 KYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 K IK+IEFLP VP ++ +GK++ ++IKA FLCA+LRL Sbjct: 381 KIKSLIKKIEFLPFVPEIISSGKQFAMQSIKAPFLCAQLRL 421 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK S+LYI Sbjct: 357 GSLFTAPYKGSDLYI 371 >ref|XP_007039777.1| O-fucosyltransferase family protein, putative isoform 2 [Theobroma cacao] gi|508777022|gb|EOY24278.1| O-fucosyltransferase family protein, putative isoform 2 [Theobroma cacao] Length = 514 Score = 48.9 bits (115), Expect(2) = 1e-06 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = -3 Query: 446 KYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 K IK+IEFLP VP ++ +GK++ ++IKA FLCA+LRL Sbjct: 318 KIKSLIKKIEFLPFVPEIISSGKQFAMQSIKAPFLCAQLRL 358 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK S+LYI Sbjct: 294 GSLFTAPYKGSDLYI 308 >gb|EXC02106.1| hypothetical protein L484_024071 [Morus notabilis] Length = 512 Score = 47.4 bits (111), Expect(2) = 1e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = -3 Query: 458 QQIHKYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 Q+I K I++IEFLP VP V+ AGK + +TI+A FLCA+LRL Sbjct: 315 QRIQK---LIEKIEFLPFVPEVISAGKRFARETIQAPFLCAQLRL 356 Score = 30.8 bits (68), Expect(2) = 1e-06 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GS+FTSPYK SELYI Sbjct: 292 GSIFTSPYKGSELYI 306 >ref|XP_002521236.1| conserved hypothetical protein [Ricinus communis] gi|223539504|gb|EEF41092.1| conserved hypothetical protein [Ricinus communis] Length = 506 Score = 45.4 bits (106), Expect(3) = 2e-06 Identities = 21/45 (46%), Positives = 32/45 (71%) Frame = -3 Query: 458 QQIHKYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 Q+ + IK+ +FLP VP ++ AG+++ +TIKA FLCA+LRL Sbjct: 309 QRDQRIQSLIKKSQFLPFVPELLNAGRKFALETIKAPFLCAQLRL 353 Score = 30.4 bits (67), Expect(3) = 2e-06 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK SELYI Sbjct: 289 GSLFTAPYKGSELYI 303 Score = 20.8 bits (42), Expect(3) = 2e-06 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 474 DIHESSTDPQIQS 436 DIHE+ D +IQS Sbjct: 304 DIHEAQRDQRIQS 316 >ref|XP_006477145.1| PREDICTED: uncharacterized protein LOC102619700 [Citrus sinensis] Length = 496 Score = 49.3 bits (116), Expect(2) = 2e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = -3 Query: 431 IKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 I++IEF+P VP ++ AGK+Y +TIKA FLCA+LRL Sbjct: 317 IEKIEFIPFVPEILSAGKKYAFETIKAPFLCAQLRL 352 Score = 28.1 bits (61), Expect(2) = 2e-06 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 G+LFT+PYK S+LYI Sbjct: 288 GTLFTAPYKGSQLYI 302 >ref|XP_006440263.1| hypothetical protein CICLE_v10019844mg [Citrus clementina] gi|557542525|gb|ESR53503.1| hypothetical protein CICLE_v10019844mg [Citrus clementina] Length = 496 Score = 48.9 bits (115), Expect(2) = 2e-06 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = -3 Query: 431 IKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 I+ IEF+P VP ++ AGK+Y +TIKA FLCA+LRL Sbjct: 317 IENIEFIPFVPEILSAGKKYAFETIKAPFLCAQLRL 352 Score = 28.1 bits (61), Expect(2) = 2e-06 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 G+LFT+PYK S+LYI Sbjct: 288 GTLFTAPYKGSQLYI 302 >ref|XP_004503386.1| PREDICTED: uncharacterized protein LOC101504282 isoform X1 [Cicer arietinum] gi|502138386|ref|XP_004503387.1| PREDICTED: uncharacterized protein LOC101504282 isoform X2 [Cicer arietinum] Length = 490 Score = 50.8 bits (120), Expect(2) = 3e-06 Identities = 23/44 (52%), Positives = 33/44 (75%) Frame = -3 Query: 455 QIHKYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 Q ++ +++I+FLP VP +MIAG E+ +TIKA FLCA+LRL Sbjct: 298 QDQRFLSLMEKIKFLPFVPEIMIAGNEFAKETIKAPFLCAQLRL 341 Score = 25.8 bits (55), Expect(2) = 3e-06 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLF++PYK SE Y+ Sbjct: 277 GSLFSAPYKGSESYL 291 >gb|ABD65093.1| hypothetical protein 31.t00055 [Brassica oleracea] Length = 521 Score = 45.8 bits (107), Expect(2) = 4e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = -3 Query: 431 IKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 I+++EFLP V VM AGK + + TIKA FLCA+LRL Sbjct: 335 IEKVEFLPFVREVMSAGKRFATGTIKAPFLCAQLRL 370 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK SELYI Sbjct: 306 GSLFTAPYKGSELYI 320 >ref|XP_003630908.1| CigA protein [Medicago truncatula] gi|355524930|gb|AET05384.1| CigA protein [Medicago truncatula] Length = 486 Score = 49.7 bits (117), Expect(2) = 4e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = -3 Query: 455 QIHKYNPFIKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 Q ++ +++I+FLP VP VM AGKE+ TIKA FLCA+LRL Sbjct: 296 QDQRFLSLMEKIKFLPYVPEVMNAGKEFAKTTIKAPFLCAQLRL 339 Score = 26.6 bits (57), Expect(2) = 4e-06 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLF++PYK SE YI Sbjct: 275 GSLFSAPYKGSESYI 289 >ref|XP_006355417.1| PREDICTED: uncharacterized protein LOC102586517 [Solanum tuberosum] Length = 495 Score = 47.8 bits (112), Expect(3) = 7e-06 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = -3 Query: 431 IKEIEFLPSVPVVMIAGKEYGSKTIKASFLCARLRL 324 IK+IEFLP VP ++ AGK++ +TIK FLCA+LRL Sbjct: 312 IKKIEFLPFVPEIINAGKKFALQTIKGPFLCAQLRL 347 Score = 25.8 bits (55), Expect(3) = 7e-06 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 523 GSLFTSPYKTSELYI 479 GSLFT+PYK SE ++ Sbjct: 283 GSLFTAPYKGSESHV 297 Score = 20.8 bits (42), Expect(3) = 7e-06 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 474 DIHESSTDPQIQS 436 DIHE+ DP +Q+ Sbjct: 298 DIHEAPNDPIVQT 310