BLASTX nr result
ID: Paeonia25_contig00003784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00003784 (477 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002473114.1| predicted protein [Postia placenta Mad-698-R... 62 1e-07 emb|CCM01462.1| predicted protein [Fibroporia radiculosa] 60 3e-07 gb|EIW63108.1| Phosphomevalonate kinase [Trametes versicolor FP-... 60 3e-07 gb|EPS94393.1| hypothetical protein FOMPIDRAFT_62407, partial [F... 55 8e-06 >ref|XP_002473114.1| predicted protein [Postia placenta Mad-698-R] gi|220727775|gb|EED81684.1| predicted protein [Postia placenta Mad-698-R] Length = 521 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/76 (43%), Positives = 45/76 (59%) Frame = -1 Query: 261 PTRPAARSD*LYRFGSGFGIWNGTGNWEWKWDAAGGFDAVWLLVLDPADCARAELPATRV 82 P P +++ L SG G+ G AGG+DA+WLLVLDP +C ELP++R Sbjct: 424 PIEPPEQTELLDACMSGAGVIGGGV------PGAGGYDAIWLLVLDPTNCPPQELPSSR- 476 Query: 81 VEHVWAKWAGVRVTPL 34 +E VWA W G+ V+PL Sbjct: 477 IEGVWASWKGLDVSPL 492 >emb|CCM01462.1| predicted protein [Fibroporia radiculosa] Length = 545 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -1 Query: 162 AGGFDAVWLLVLDPADCARAELPATRVVEHVWAKWAGVRVTPL 34 AGG+DA+WLLVLDP +C AELP++R VE W W G+ V+PL Sbjct: 475 AGGYDAIWLLVLDPLNCPPAELPSSR-VERAWTNWKGLDVSPL 516 >gb|EIW63108.1| Phosphomevalonate kinase [Trametes versicolor FP-101664 SS1] Length = 515 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -1 Query: 162 AGGFDAVWLLVLDPADCARAELPATRVVEHVWAKWAGVRVTPLL 31 AGG+DA+WLLVLDP +C ELP+TR VE VW+ + G+ V+PLL Sbjct: 446 AGGYDAIWLLVLDPVNCPPEELPSTR-VERVWSTYTGLDVSPLL 488 >gb|EPS94393.1| hypothetical protein FOMPIDRAFT_62407, partial [Fomitopsis pinicola FP-58527 SS1] Length = 529 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -1 Query: 162 AGGFDAVWLLVLDPADCARAELPATRVVEHVWAKWAGVRVTPL 34 AGG+DA+WLLVLDP C ELP++R +E VWA++ G+ V+PL Sbjct: 459 AGGYDAIWLLVLDPVICPPHELPSSR-IEGVWAEYKGMDVSPL 500