BLASTX nr result
ID: Paeonia25_contig00001879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00001879 (1748 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT24797.1| hypothetical protein F775_17517 [Aegilops tauschii] 59 5e-06 >gb|EMT24797.1| hypothetical protein F775_17517 [Aegilops tauschii] Length = 406 Score = 59.3 bits (142), Expect = 5e-06 Identities = 55/163 (33%), Positives = 75/163 (46%), Gaps = 12/163 (7%) Frame = -3 Query: 783 ELHIEILIRIPLGEVNLCKS--VSRQWHQLISDPSFL----------VAHHIGNISLLGF 640 +L EIL+R+P L ++ V ++W L+SDP FL HH N LLGF Sbjct: 17 DLLSEILLRLPPQPSFLPRASLVYKRWRSLVSDPGFLSLVSSFLRRFCVHHRRNPPLLGF 76 Query: 639 FYNNASFRVKFFPLAPTKDYFAPFYNIVQQQVSPWSTWNSWFATLCSSNGLVLLLDHYEE 460 F N FR F APT AP + PW +S F+ L +GLVL+ D Sbjct: 77 F--NTGFRKTSF--APT--LMAPDRVPRGRFSLPWGDVSS-FSLLNCRHGLVLIFDETRR 129 Query: 459 IFFLYDPITGQILRLPRPPLIDDEGLAPRINRPQRRFIVYGLA 331 F ++DP+TG R+ P ++ G R R F V +A Sbjct: 130 QFIVWDPVTGDQHRVDVPAPLEINGAVLRAAGDVRHFQVVFVA 172