BLASTX nr result
ID: Paeonia25_contig00001078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00001078 (589 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515928.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 >ref|XP_002515928.1| conserved hypothetical protein [Ricinus communis] gi|223544833|gb|EEF46348.1| conserved hypothetical protein [Ricinus communis] Length = 73 Score = 58.9 bits (141), Expect = 1e-06 Identities = 34/75 (45%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Frame = +3 Query: 141 AGNSSRSILAILFILAMVVTPMLPCEAVRFSERDSV---EPTINCTCVCVQAP-----CD 296 A +S +S L LFI AMV++PM+P EA R ++RD + EP CVC P CD Sbjct: 2 ASSSLKSFLVTLFIFAMVLSPMIPSEAARMNQRDLLQTNEPIFCPACVCCSPPPPGQCCD 61 Query: 297 CCDYPDPTEPATGSP 341 CC P P TGSP Sbjct: 62 CCATP---VPDTGSP 73