BLASTX nr result
ID: Paeonia24_contig00042566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00042566 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521672.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002521672.1| conserved hypothetical protein [Ricinus communis] gi|223539063|gb|EEF40659.1| conserved hypothetical protein [Ricinus communis] Length = 410 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +3 Query: 183 GKKWSNLPQELLRMIGKFMDTRIDVARFRAVCPSW 287 G++W++LPQELL +I K +D+RIDV RFRAVC SW Sbjct: 7 GREWADLPQELLEIISKHLDSRIDVYRFRAVCTSW 41