BLASTX nr result
ID: Paeonia24_contig00041891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00041891 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518554.1| ATP binding protein, putative [Ricinus commu... 59 7e-07 ref|XP_007152378.1| hypothetical protein PHAVU_004G125100g [Phas... 57 3e-06 ref|XP_004496789.1| PREDICTED: cysteine-rich receptor-like prote... 56 5e-06 ref|XP_004496788.1| PREDICTED: cysteine-rich receptor-like prote... 56 5e-06 ref|XP_003543377.1| PREDICTED: cysteine-rich repeat secretory pr... 56 5e-06 ref|XP_003612357.1| Cysteine-rich receptor-like protein kinase [... 56 5e-06 ref|XP_003638035.1| Cysteine-rich receptor-like protein kinase [... 56 5e-06 ref|XP_003637976.1| Cysteine-rich receptor-like protein kinase [... 56 5e-06 ref|XP_003619533.1| Cysteine-rich receptor-like protein kinase [... 56 5e-06 ref|XP_006467962.1| PREDICTED: cysteine-rich receptor-like prote... 56 6e-06 ref|XP_006351952.1| PREDICTED: cysteine-rich repeat secretory pr... 56 6e-06 ref|XP_007149948.1| hypothetical protein PHAVU_005G112800g [Phas... 56 6e-06 ref|XP_007140021.1| hypothetical protein PHAVU_008G077500g [Phas... 56 6e-06 ref|XP_007140020.1| hypothetical protein PHAVU_008G077500g [Phas... 56 6e-06 ref|XP_006449120.1| hypothetical protein CICLE_v10014504mg [Citr... 56 6e-06 ref|XP_004511333.1| PREDICTED: cysteine-rich receptor-like prote... 56 6e-06 ref|XP_004511332.1| PREDICTED: cysteine-rich receptor-like prote... 56 6e-06 ref|XP_006602743.1| PREDICTED: putative cysteine-rich receptor-l... 55 8e-06 ref|XP_006602742.1| PREDICTED: putative cysteine-rich receptor-l... 55 8e-06 >ref|XP_002518554.1| ATP binding protein, putative [Ricinus communis] gi|223542399|gb|EEF43941.1| ATP binding protein, putative [Ricinus communis] Length = 579 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/66 (46%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = -1 Query: 299 ANLAANDESXXXXXXXXXXXXXTVYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGG 123 A+ AA+ E +Y LVQCT DLS DC +CL TAI+ LPS C GK GG Sbjct: 172 ASTAASGEKKFAVKEDSFTSFQKLYSLVQCTPDLSTSDCGQCLQTAISNLPSCCGGKQGG 231 Query: 122 RAVFPS 105 R ++PS Sbjct: 232 RVLYPS 237 >ref|XP_007152378.1| hypothetical protein PHAVU_004G125100g [Phaseolus vulgaris] gi|561025687|gb|ESW24372.1| hypothetical protein PHAVU_004G125100g [Phaseolus vulgaris] Length = 912 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/43 (58%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLP-SCSGKTGGRAVFPS 105 VYCL QCT DLS +DC++CL I LP C GK GGR ++PS Sbjct: 201 VYCLAQCTPDLSPNDCRRCLSAVIGDLPWCCQGKQGGRVLYPS 243 >ref|XP_004496789.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like isoform X2 [Cicer arietinum] Length = 670 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPS 105 +YCL QCT DLS DC+ CL AI LP C GK GGR +FPS Sbjct: 203 LYCLAQCTEDLSPQDCRICLSDAIGDLPQCCEGKQGGRVLFPS 245 >ref|XP_004496788.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like isoform X1 [Cicer arietinum] Length = 675 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPS 105 +YCL QCT DLS DC+ CL AI LP C GK GGR +FPS Sbjct: 203 LYCLAQCTEDLSPQDCRICLSDAIGDLPQCCEGKQGGRVLFPS 245 >ref|XP_003543377.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Glycine max] Length = 244 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPSIKF 96 +Y L QCT DLS+ DCKKCL AIN+LP+ C GK GGR V S F Sbjct: 189 LYGLTQCTRDLSSSDCKKCLDDAINELPNCCDGKEGGRVVSGSCNF 234 >ref|XP_003612357.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355513692|gb|AES95315.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 292 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPS 105 +YC+ QCT DLS DC+ CL AI LP C GK GGR +FPS Sbjct: 206 LYCMAQCTEDLSQQDCRTCLSDAIGALPQCCDGKQGGRVLFPS 248 >ref|XP_003638035.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355503970|gb|AES85173.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 657 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPS 105 +YC+ QCT DLS DC+ CL AI LP C GK GGR +FPS Sbjct: 196 LYCMAQCTEDLSQQDCRTCLSDAIGALPQCCDGKQGGRVLFPS 238 >ref|XP_003637976.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355503911|gb|AES85114.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 661 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPS 105 +YC+ QCT DLS DC+ CL AI LP C GK GGR +FPS Sbjct: 200 LYCMAQCTEDLSQQDCRTCLSDAIGALPQCCDGKQGGRVLFPS 242 >ref|XP_003619533.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355494548|gb|AES75751.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 510 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKL-PSCSGKTGGRAVFPS 105 +YCL QCT DLS +DC+ CL +AI K+ SC GK GGR ++PS Sbjct: 197 LYCLAQCTPDLSPNDCRTCLSSAIEKVSKSCDGKVGGRFLYPS 239 >ref|XP_006467962.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Citrus sinensis] Length = 674 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPS 105 +Y L QCT DLS+ DC CL A+ +LPS CSGK GGR +FPS Sbjct: 196 LYSLAQCTPDLSSSDCNTCLRGAVARLPSCCSGKQGGRVLFPS 238 >ref|XP_006351952.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum tuberosum] Length = 244 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPSIKF 96 +Y LVQCT DLS +DCKKCL IN+LPS C GK GGR + S F Sbjct: 188 LYGLVQCTRDLSNEDCKKCLDGIINELPSCCDGKEGGRVISGSCNF 233 >ref|XP_007149948.1| hypothetical protein PHAVU_005G112800g [Phaseolus vulgaris] gi|561023212|gb|ESW21942.1| hypothetical protein PHAVU_005G112800g [Phaseolus vulgaris] Length = 253 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/46 (60%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPSIKF 96 +Y L QCT DLS++DCKKCL AI++LPS C GK GGR V S F Sbjct: 198 LYGLTQCTRDLSSNDCKKCLDDAIDELPSCCDGKEGGRVVSGSCNF 243 >ref|XP_007140021.1| hypothetical protein PHAVU_008G077500g [Phaseolus vulgaris] gi|561013154|gb|ESW12015.1| hypothetical protein PHAVU_008G077500g [Phaseolus vulgaris] Length = 918 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/66 (43%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = -1 Query: 299 ANLAANDESXXXXXXXXXXXXXTVYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGG 123 A+ AAN T+YCL QCT DLS C +CL AI+ +P+ C+GK GG Sbjct: 193 AHEAANSSKRYSAKQENLSENQTLYCLTQCTQDLSPQQCSQCLDDAISNIPTCCNGKQGG 252 Query: 122 RAVFPS 105 R +FPS Sbjct: 253 RVLFPS 258 >ref|XP_007140020.1| hypothetical protein PHAVU_008G077500g [Phaseolus vulgaris] gi|561013153|gb|ESW12014.1| hypothetical protein PHAVU_008G077500g [Phaseolus vulgaris] Length = 873 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/66 (43%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = -1 Query: 299 ANLAANDESXXXXXXXXXXXXXTVYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGG 123 A+ AAN T+YCL QCT DLS C +CL AI+ +P+ C+GK GG Sbjct: 193 AHEAANSSKRYSAKQENLSENQTLYCLTQCTQDLSPQQCSQCLDDAISNIPTCCNGKQGG 252 Query: 122 RAVFPS 105 R +FPS Sbjct: 253 RVLFPS 258 >ref|XP_006449120.1| hypothetical protein CICLE_v10014504mg [Citrus clementina] gi|557551731|gb|ESR62360.1| hypothetical protein CICLE_v10014504mg [Citrus clementina] Length = 671 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPS 105 +Y L QCT DLS+ DC CL A+ +LPS CSGK GGR +FPS Sbjct: 200 LYSLAQCTPDLSSSDCNACLRGAVARLPSCCSGKQGGRVLFPS 242 >ref|XP_004511333.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like isoform X2 [Cicer arietinum] Length = 683 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/43 (55%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLP-SCSGKTGGRAVFPS 105 +YCL QCT DLS DC++CL I LP C+GK GGR ++PS Sbjct: 211 LYCLAQCTNDLSPQDCRRCLSAVIGDLPWCCTGKQGGRVLYPS 253 >ref|XP_004511332.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like isoform X1 [Cicer arietinum] Length = 684 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/43 (55%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLP-SCSGKTGGRAVFPS 105 +YCL QCT DLS DC++CL I LP C+GK GGR ++PS Sbjct: 211 LYCLAQCTNDLSPQDCRRCLSAVIGDLPWCCTGKQGGRVLYPS 253 >ref|XP_006602743.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 23-like isoform X2 [Glycine max] Length = 901 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPS 105 +YCL QCT DLS +C CL AI LP C GK GGR VFPS Sbjct: 195 LYCLAQCTQDLSPQNCTACLTQAIEYLPDCCEGKQGGRVVFPS 237 >ref|XP_006602742.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 23-like isoform X1 [Glycine max] Length = 903 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -1 Query: 230 VYCLVQCTLDLSADDCKKCLLTAINKLPS-CSGKTGGRAVFPS 105 +YCL QCT DLS +C CL AI LP C GK GGR VFPS Sbjct: 195 LYCLAQCTQDLSPQNCTACLTQAIEYLPDCCEGKQGGRVVFPS 237