BLASTX nr result
ID: Paeonia24_contig00041886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00041886 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039748.1| Cysteine/Histidine-rich C1 domain family pro... 58 1e-06 >ref|XP_007039748.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao] gi|508776993|gb|EOY24249.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao] Length = 754 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/41 (53%), Positives = 30/41 (73%) Frame = -1 Query: 298 EFYCYACEKERNSYDPVFYCAECQFVAEIGCVIDEILPSLS 176 EFYC ACEK+R+ +PV+YC C+F+ E GCV +LP L+ Sbjct: 530 EFYCDACEKKRDKENPVYYCVSCKFIVETGCVTSALLPFLT 570