BLASTX nr result
ID: Paeonia24_contig00041649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00041649 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006448599.1| hypothetical protein CICLE_v10014519mg [Citr... 67 2e-09 ref|XP_006468575.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_002275605.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 emb|CBI27232.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_004232626.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_002867892.1| EMB1025 [Arabidopsis lyrata subsp. lyrata] g... 64 2e-08 ref|XP_006404148.1| hypothetical protein EUTSA_v10010168mg [Eutr... 64 3e-08 ref|XP_006363176.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|NP_193742.1| pentatricopeptide repeat-containing protein [Ar... 62 8e-08 ref|XP_006283284.1| hypothetical protein CARUB_v10004320mg [Caps... 62 1e-07 ref|XP_007040996.1| Pentatricopeptide repeat (PPR) superfamily p... 61 2e-07 ref|XP_007211368.1| hypothetical protein PRUPE_ppa002507mg [Prun... 60 2e-07 ref|XP_002528143.1| pentatricopeptide repeat-containing protein,... 60 3e-07 ref|XP_002297917.1| hypothetical protein POPTR_0001s12190g [Popu... 58 1e-06 ref|XP_002304600.2| hypothetical protein POPTR_0003s15360g [Popu... 58 2e-06 >ref|XP_006448599.1| hypothetical protein CICLE_v10014519mg [Citrus clementina] gi|557551210|gb|ESR61839.1| hypothetical protein CICLE_v10014519mg [Citrus clementina] Length = 664 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDL 113 MLQK+L PKTSTWERVV LC+PK+IQ AINKCWS+L Sbjct: 626 MLQKFLPPKTSTWERVVQELCRPKRIQAAINKCWSNL 662 >ref|XP_006468575.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Citrus sinensis] Length = 664 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDL 113 MLQK+L+P+TSTWERVV LC+PK+IQ AINKCWS+L Sbjct: 626 MLQKFLSPQTSTWERVVQELCRPKRIQAAINKCWSNL 662 >ref|XP_002275605.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Vitis vinifera] Length = 644 Score = 65.1 bits (157), Expect = 1e-08 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDLCF 119 MLQK+L P STWER++P LCKPKK+Q I+KCWS L F Sbjct: 606 MLQKFLPPNASTWERIIPELCKPKKVQAIIDKCWSSLFF 644 >emb|CBI27232.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 65.1 bits (157), Expect = 1e-08 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDLCF 119 MLQK+L P STWER++P LCKPKK+Q I+KCWS L F Sbjct: 622 MLQKFLPPNASTWERIIPELCKPKKVQAIIDKCWSSLFF 660 >ref|XP_004232626.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Solanum lycopersicum] Length = 717 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDL 113 MLQK L+PK+STWE ++ LCKPKK+Q AINKCWSDL Sbjct: 679 MLQKILSPKSSTWEMIIRELCKPKKVQGAINKCWSDL 715 >ref|XP_002867892.1| EMB1025 [Arabidopsis lyrata subsp. lyrata] gi|297313728|gb|EFH44151.1| EMB1025 [Arabidopsis lyrata subsp. lyrata] Length = 658 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDL 113 ML KYLAPKTSTW +VP +CKPKKI AINKCW +L Sbjct: 622 MLGKYLAPKTSTWAMIVPEICKPKKINAAINKCWRNL 658 >ref|XP_006404148.1| hypothetical protein EUTSA_v10010168mg [Eutrema salsugineum] gi|557105267|gb|ESQ45601.1| hypothetical protein EUTSA_v10010168mg [Eutrema salsugineum] Length = 696 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDLC 116 ML KYL PK STW +VP +CKPKKI VAI+KCW ++C Sbjct: 658 MLSKYLTPKASTWAMIVPEICKPKKINVAIDKCWRNMC 695 >ref|XP_006363176.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X1 [Solanum tuberosum] gi|565395083|ref|XP_006363177.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X2 [Solanum tuberosum] Length = 717 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDL 113 MLQK + PK+STWE ++ LCKPKK+Q AINKCWSDL Sbjct: 679 MLQKIIYPKSSTWEMIIRELCKPKKVQGAINKCWSDL 715 >ref|NP_193742.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75098720|sp|O49436.1|PP327_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g20090; AltName: Full=Protein EMBRYO DEFECTIVE 1025 gi|2827663|emb|CAA16617.1| membrane-associated salt-inducible-like protein [Arabidopsis thaliana] gi|7268804|emb|CAB79009.1| membrane-associated salt-inducible-like protein [Arabidopsis thaliana] gi|58013024|gb|AAW62965.1| embryo-defective 1025 [Arabidopsis thaliana] gi|332658871|gb|AEE84271.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 660 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDLC 116 ML KYLAPKTSTW +V +CKPKKI AI+KCW +LC Sbjct: 622 MLGKYLAPKTSTWAMIVREICKPKKINAAIDKCWRNLC 659 >ref|XP_006283284.1| hypothetical protein CARUB_v10004320mg [Capsella rubella] gi|482551989|gb|EOA16182.1| hypothetical protein CARUB_v10004320mg [Capsella rubella] Length = 660 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDLC 116 ML KYL PK STW +VP +CKPKKI AI+KCW +LC Sbjct: 622 MLDKYLTPKISTWVLIVPEICKPKKINAAIDKCWRNLC 659 >ref|XP_007040996.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508704931|gb|EOX96827.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 636 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDL 113 MLQK+L PK STW RVV LCKPKKIQ AI+KCW ++ Sbjct: 598 MLQKFLPPKASTWARVVEELCKPKKIQAAIDKCWRNI 634 >ref|XP_007211368.1| hypothetical protein PRUPE_ppa002507mg [Prunus persica] gi|462407233|gb|EMJ12567.1| hypothetical protein PRUPE_ppa002507mg [Prunus persica] Length = 664 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDLCF 119 MLQK+L PK STW RVV LCKPK ++ AI+KCWS L F Sbjct: 626 MLQKFLPPKASTWTRVVQELCKPKMVRAAIDKCWSSLYF 664 >ref|XP_002528143.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532441|gb|EEF34234.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 653 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDL 113 MLQK+L+PK STW RVV LC+PKKIQ I+KCWS L Sbjct: 615 MLQKFLSPKASTWARVVHELCQPKKIQAVIDKCWSKL 651 >ref|XP_002297917.1| hypothetical protein POPTR_0001s12190g [Populus trichocarpa] gi|222845175|gb|EEE82722.1| hypothetical protein POPTR_0001s12190g [Populus trichocarpa] Length = 670 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDL 113 MLQK L PK STW RVV LCKPKK+Q I KCWS L Sbjct: 633 MLQKLLPPKHSTWARVVENLCKPKKVQAVIQKCWSIL 669 >ref|XP_002304600.2| hypothetical protein POPTR_0003s15360g [Populus trichocarpa] gi|550343237|gb|EEE79579.2| hypothetical protein POPTR_0003s15360g [Populus trichocarpa] Length = 672 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = +3 Query: 3 MLQKYLAPKTSTWERVVPGLCKPKKIQVAINKCWSDL 113 MLQK L PK STW RVV LC PKK+Q AI KCWS L Sbjct: 634 MLQKLLPPKPSTWTRVVEDLCNPKKVQAAIQKCWSIL 670