BLASTX nr result
ID: Paeonia24_contig00041511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00041511 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007216842.1| hypothetical protein PRUPE_ppa022058mg, part... 68 1e-09 ref|XP_007140920.1| hypothetical protein PHAVU_008G152300g [Phas... 58 2e-06 ref|XP_007031415.1| NHL domain-containing protein, putative [The... 56 6e-06 >ref|XP_007216842.1| hypothetical protein PRUPE_ppa022058mg, partial [Prunus persica] gi|462412992|gb|EMJ18041.1| hypothetical protein PRUPE_ppa022058mg, partial [Prunus persica] Length = 135 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/47 (76%), Positives = 36/47 (76%), Gaps = 3/47 (6%) Frame = -1 Query: 238 LNFDEGTSQ---LDDDYASRHFSSRYASIPASAKSMMDLGKDCPSFT 107 LNFDEG Q LDDDY R FS RYASIPASAKS MDLGKD PSFT Sbjct: 89 LNFDEGPGQSGNLDDDYLHRDFSCRYASIPASAKSSMDLGKDGPSFT 135 >ref|XP_007140920.1| hypothetical protein PHAVU_008G152300g [Phaseolus vulgaris] gi|561014053|gb|ESW12914.1| hypothetical protein PHAVU_008G152300g [Phaseolus vulgaris] Length = 141 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -1 Query: 235 NFDEGTSQLDDDYASRHFSSRYASIPASAKSMMDLGKDCPSFT 107 NFD+GT + ++ FSSRYAS+P+SAKS MDLGKD PSFT Sbjct: 99 NFDDGTREKRQEHYGCDFSSRYASVPSSAKSSMDLGKDGPSFT 141 >ref|XP_007031415.1| NHL domain-containing protein, putative [Theobroma cacao] gi|508710444|gb|EOY02341.1| NHL domain-containing protein, putative [Theobroma cacao] Length = 810 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/44 (61%), Positives = 32/44 (72%), Gaps = 3/44 (6%) Frame = -1 Query: 238 LNFDEGTSQ---LDDDYASRHFSSRYASIPASAKSMMDLGKDCP 116 LNFDEG Q D+D+ +R+FSSRYAS+P S KS MD GKD P Sbjct: 764 LNFDEGPGQNGHFDEDFMNRNFSSRYASLPVSTKSSMDFGKDGP 807