BLASTX nr result
ID: Paeonia24_contig00040741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00040741 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 >ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vitis vinifera] gi|297745328|emb|CBI40408.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 73.9 bits (180), Expect = 2e-11 Identities = 40/73 (54%), Positives = 46/73 (63%), Gaps = 2/73 (2%) Frame = +2 Query: 35 TVAIKNSNLFRLLKSQTSTNQFVLLRHLSTEIDQ--PRPSLAGNESSVTTQVIKLLQTTD 208 TV+ K S L R L+ QT N LLRHLS E D P P + SSV V++LLQTTD Sbjct: 6 TVSSKQSKLLRFLRPQTPPNLSSLLRHLSAEPDHHPPAPPPQNDSSSVVNLVVELLQTTD 65 Query: 209 NDWNTDELHHLLF 247 NDWN D+LH LLF Sbjct: 66 NDWNEDKLHQLLF 78