BLASTX nr result
ID: Paeonia24_contig00040698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00040698 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83231.1| hypothetical protein VITISV_018480 [Vitis vinifera] 59 9e-07 >emb|CAN83231.1| hypothetical protein VITISV_018480 [Vitis vinifera] Length = 357 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 5/79 (6%) Frame = -3 Query: 226 RPQPAYQQVRCTICLCDFI*EESLISLPHCLHAFHAKFMDPYFTESGTTCLICRQPISFS 47 +P + ++ C +CLCD + E L LP C H FH +D +F ++ +TC +CR +S Sbjct: 53 KPNRTHXZIYCVVCLCDAVEGERLRRLPDCKHCFHVGCIDAWF-QAHSTCPLCRSQVSLP 111 Query: 46 HR-----YDFFISCMYLCA 5 HR + F+S + L A Sbjct: 112 HRRQPTLFSHFLSLLKLIA 130