BLASTX nr result
ID: Paeonia24_contig00040673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00040673 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613303.1| hypothetical protein MTR_5g035070 [Medicago ... 66 4e-09 ref|XP_003519542.1| PREDICTED: protein YLS7-like isoform X1 [Gly... 63 5e-08 ref|XP_003517820.1| PREDICTED: protein YLS7-like [Glycine max] 60 2e-07 gb|AFK42435.1| unknown [Lotus japonicus] 59 5e-07 ref|XP_007157485.1| hypothetical protein PHAVU_002G073600g [Phas... 57 2e-06 >ref|XP_003613303.1| hypothetical protein MTR_5g035070 [Medicago truncatula] gi|355514638|gb|AES96261.1| hypothetical protein MTR_5g035070 [Medicago truncatula] Length = 444 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/45 (73%), Positives = 34/45 (75%) Frame = +1 Query: 154 VNEMGTFNPFKDQSHPLTKKLLPWTLYVLLPIGLLSLYFSNPLPF 288 V +MG NPFKDQ H LTKKL PWTLY LLPI LLSLY PLPF Sbjct: 2 VMKMGISNPFKDQLHSLTKKLFPWTLYALLPIALLSLYL-YPLPF 45 >ref|XP_003519542.1| PREDICTED: protein YLS7-like isoform X1 [Glycine max] gi|571438530|ref|XP_006574593.1| PREDICTED: protein YLS7-like isoform X2 [Glycine max] Length = 440 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = +1 Query: 163 MGTFNPFKDQSHPLTKKLLPWTLYVLLPIGLLSLYFSNPLPF 288 MG NPFKDQS LTK+LLPWTLY LLPI LL LYF PLPF Sbjct: 1 MGITNPFKDQSLSLTKRLLPWTLYALLPIVLLRLYF-YPLPF 41 >ref|XP_003517820.1| PREDICTED: protein YLS7-like [Glycine max] Length = 440 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/42 (73%), Positives = 32/42 (76%) Frame = +1 Query: 163 MGTFNPFKDQSHPLTKKLLPWTLYVLLPIGLLSLYFSNPLPF 288 MG NPFKDQS L K+LLPWTLY LLPI LL LYF PLPF Sbjct: 1 MGITNPFKDQSLSLIKRLLPWTLYALLPIVLLRLYF-YPLPF 41 >gb|AFK42435.1| unknown [Lotus japonicus] Length = 263 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = +1 Query: 163 MGTFNPFKDQSHPLTKKLLPWTLYVLLPIGLLSLYFSNPLPF 288 MGT N FKDQS TK+L+PWTLY LLPI LL LYF PLPF Sbjct: 1 MGTTNQFKDQSISFTKRLVPWTLYALLPIVLLRLYF-YPLPF 41 >ref|XP_007157485.1| hypothetical protein PHAVU_002G073600g [Phaseolus vulgaris] gi|593788894|ref|XP_007157486.1| hypothetical protein PHAVU_002G073600g [Phaseolus vulgaris] gi|561030900|gb|ESW29479.1| hypothetical protein PHAVU_002G073600g [Phaseolus vulgaris] gi|561030901|gb|ESW29480.1| hypothetical protein PHAVU_002G073600g [Phaseolus vulgaris] Length = 439 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 163 MGTFNPFKDQSHPLTKKLLPWTLYVLLPIGLLSLYFSNPLPF 288 MG +PFKDQS +TK+LLPWTLY LLPI LL LYF P PF Sbjct: 1 MGITSPFKDQSLSITKRLLPWTLYALLPILLLRLYF-YPQPF 41