BLASTX nr result
ID: Paeonia24_contig00040605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00040605 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268853.1| PREDICTED: pentatricopeptide repeat-containi... 116 4e-24 ref|XP_002533783.1| pentatricopeptide repeat-containing protein,... 115 8e-24 emb|CBI31086.3| unnamed protein product [Vitis vinifera] 114 1e-23 ref|XP_007198953.1| hypothetical protein PRUPE_ppa018505mg [Prun... 113 2e-23 ref|XP_006587119.1| PREDICTED: pentatricopeptide repeat-containi... 112 4e-23 ref|XP_003630936.1| Pentatricopeptide repeat-containing protein ... 112 5e-23 ref|XP_007022988.1| Tetratricopeptide repeat (TPR)-like superfam... 111 9e-23 ref|XP_007022987.1| Tetratricopeptide repeat (TPR)-like superfam... 111 9e-23 ref|XP_007138522.1| hypothetical protein PHAVU_009G216300g [Phas... 111 1e-22 gb|EXB75175.1| hypothetical protein L484_025954 [Morus notabilis] 108 1e-21 ref|XP_004290399.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 ref|XP_004158080.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 ref|XP_004135750.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 ref|XP_004503357.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_003547574.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 ref|XP_006468372.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|NP_193861.1| pentatricopeptide repeat-containing protein [Ar... 100 2e-19 ref|XP_006286154.1| hypothetical protein CARUB_v10007713mg [Caps... 99 6e-19 ref|XP_002869895.1| pentatricopeptide repeat-containing protein ... 99 6e-19 ref|XP_006448816.1| hypothetical protein CICLE_v10014257mg [Citr... 95 1e-17 >ref|XP_002268853.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Vitis vinifera] Length = 853 Score = 116 bits (290), Expect = 4e-24 Identities = 53/69 (76%), Positives = 62/69 (89%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+RGV+KVPG SWI++N+TTHMFVAAD SHP+S++IY LLKNL ELRKEGYVPQ YLP Sbjct: 780 MKERGVQKVPGCSWIDVNNTTHMFVAADRSHPQSSQIYLLLKNLFLELRKEGYVPQLYLP 839 Query: 181 MHPQIMGVQ 207 MHPQ MG+Q Sbjct: 840 MHPQTMGLQ 848 >ref|XP_002533783.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526284|gb|EEF28596.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 672 Score = 115 bits (287), Expect = 8e-24 Identities = 52/68 (76%), Positives = 59/68 (86%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK RGV+KVPGYSWIE+N TTHMFVAAD SHP+SA+IY +L NLL ELRKEGY P+PYLP Sbjct: 605 MKKRGVQKVPGYSWIEVNKTTHMFVAADGSHPESAQIYSVLNNLLLELRKEGYCPKPYLP 664 Query: 181 MHPQIMGV 204 MHPQ G+ Sbjct: 665 MHPQTFGL 672 >emb|CBI31086.3| unnamed protein product [Vitis vinifera] Length = 766 Score = 114 bits (285), Expect = 1e-23 Identities = 52/68 (76%), Positives = 61/68 (89%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+RGV+KVPG SWI++N+TTHMFVAAD SHP+S++IY LLKNL ELRKEGYVPQ YLP Sbjct: 681 MKERGVQKVPGCSWIDVNNTTHMFVAADRSHPQSSQIYLLLKNLFLELRKEGYVPQLYLP 740 Query: 181 MHPQIMGV 204 MHPQ MG+ Sbjct: 741 MHPQTMGL 748 >ref|XP_007198953.1| hypothetical protein PRUPE_ppa018505mg [Prunus persica] gi|462394248|gb|EMJ00152.1| hypothetical protein PRUPE_ppa018505mg [Prunus persica] Length = 758 Score = 113 bits (283), Expect = 2e-23 Identities = 51/68 (75%), Positives = 61/68 (89%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+RGV+KVPGYSWIE+N++THMFVAAD SHP+SA+IY +LK+LL ELRKEGY PQPYLP Sbjct: 691 MKERGVQKVPGYSWIEVNNSTHMFVAADGSHPQSAQIYSMLKSLLLELRKEGYNPQPYLP 750 Query: 181 MHPQIMGV 204 HPQ G+ Sbjct: 751 THPQTSGM 758 >ref|XP_006587119.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like isoform X2 [Glycine max] gi|571476945|ref|XP_003535029.2| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like isoform X1 [Glycine max] Length = 848 Score = 112 bits (281), Expect = 4e-23 Identities = 48/67 (71%), Positives = 60/67 (89%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK++GV+K+PGYSWI++N THMF AAD +HP+S EIY +LK+LL ELRK+GYVPQPYLP Sbjct: 780 MKEKGVQKIPGYSWIDVNGGTHMFSAADGNHPESVEIYLILKSLLLELRKQGYVPQPYLP 839 Query: 181 MHPQIMG 201 +HPQIMG Sbjct: 840 LHPQIMG 846 >ref|XP_003630936.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524958|gb|AET05412.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 959 Score = 112 bits (280), Expect = 5e-23 Identities = 49/69 (71%), Positives = 58/69 (84%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK++GV+K+PGYSWI++N THMF AAD HP+S EIY +LKNLL ELRK GYVPQPYLP Sbjct: 810 MKEKGVQKIPGYSWIDVNGGTHMFSAADGCHPQSVEIYLILKNLLLELRKHGYVPQPYLP 869 Query: 181 MHPQIMGVQ 207 +HPQIM Q Sbjct: 870 LHPQIMNFQ 878 >ref|XP_007022988.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 2 [Theobroma cacao] gi|508778354|gb|EOY25610.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 2 [Theobroma cacao] Length = 805 Score = 111 bits (278), Expect = 9e-23 Identities = 51/66 (77%), Positives = 59/66 (89%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+RGV+KVPGYSWIE+N+TTHMFVAAD SHP+S+ IY LLK LL EL++EGYVPQ YLP Sbjct: 738 MKERGVQKVPGYSWIEVNNTTHMFVAADESHPRSSHIYSLLKTLLLELKREGYVPQLYLP 797 Query: 181 MHPQIM 198 MHPQ M Sbjct: 798 MHPQHM 803 >ref|XP_007022987.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590614612|ref|XP_007022989.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590614615|ref|XP_007022990.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590614619|ref|XP_007022991.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590614623|ref|XP_007022992.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778353|gb|EOY25609.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778355|gb|EOY25611.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778356|gb|EOY25612.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778357|gb|EOY25613.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778358|gb|EOY25614.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 833 Score = 111 bits (278), Expect = 9e-23 Identities = 51/66 (77%), Positives = 59/66 (89%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+RGV+KVPGYSWIE+N+TTHMFVAAD SHP+S+ IY LLK LL EL++EGYVPQ YLP Sbjct: 766 MKERGVQKVPGYSWIEVNNTTHMFVAADESHPRSSHIYSLLKTLLLELKREGYVPQLYLP 825 Query: 181 MHPQIM 198 MHPQ M Sbjct: 826 MHPQHM 831 >ref|XP_007138522.1| hypothetical protein PHAVU_009G216300g [Phaseolus vulgaris] gi|561011609|gb|ESW10516.1| hypothetical protein PHAVU_009G216300g [Phaseolus vulgaris] Length = 848 Score = 111 bits (277), Expect = 1e-22 Identities = 48/67 (71%), Positives = 59/67 (88%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK++GV+K+PGYSWI++N THMF AAD +HP S EIY +LK+LL ELRK+GYVPQPYLP Sbjct: 780 MKEKGVQKIPGYSWIDVNGGTHMFSAADGNHPDSFEIYLILKSLLLELRKQGYVPQPYLP 839 Query: 181 MHPQIMG 201 +HPQIMG Sbjct: 840 LHPQIMG 846 >gb|EXB75175.1| hypothetical protein L484_025954 [Morus notabilis] Length = 850 Score = 108 bits (269), Expect = 1e-21 Identities = 49/68 (72%), Positives = 59/68 (86%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+RGVKKVPGYSWIE+N+ THMFVAAD SH +SAEIY +L +LL ELR+EGY P+PYLP Sbjct: 783 MKERGVKKVPGYSWIEINNKTHMFVAADGSHLESAEIYSVLMSLLLELRREGYAPKPYLP 842 Query: 181 MHPQIMGV 204 MH Q +G+ Sbjct: 843 MHQQTLGM 850 >ref|XP_004290399.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Fragaria vesca subsp. vesca] Length = 672 Score = 108 bits (269), Expect = 1e-21 Identities = 49/68 (72%), Positives = 60/68 (88%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 M +RGV+K+PGYSWIE+N+ TH+FVAAD+SHP+SA ++ LL LL ELRKEGY PQPYLP Sbjct: 605 MNERGVQKIPGYSWIEVNNKTHVFVAADTSHPQSAILHSLLNILLLELRKEGYNPQPYLP 664 Query: 181 MHPQIMGV 204 MHPQI+GV Sbjct: 665 MHPQIVGV 672 >ref|XP_004158080.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Cucumis sativus] Length = 762 Score = 108 bits (269), Expect = 1e-21 Identities = 48/66 (72%), Positives = 59/66 (89%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+RGV+KVPGYSWIE+N+ THMFVAAD SHP +A+IY +L +LL EL+KEGYVPQ YLP Sbjct: 691 MKERGVRKVPGYSWIEVNNATHMFVAADGSHPLTAQIYSVLDSLLLELKKEGYVPQLYLP 750 Query: 181 MHPQIM 198 MHPQ++ Sbjct: 751 MHPQLL 756 >ref|XP_004135750.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Cucumis sativus] Length = 762 Score = 108 bits (269), Expect = 1e-21 Identities = 48/66 (72%), Positives = 59/66 (89%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+RGV+KVPGYSWIE+N+ THMFVAAD SHP +A+IY +L +LL EL+KEGYVPQ YLP Sbjct: 691 MKERGVRKVPGYSWIEVNNATHMFVAADGSHPLTAQIYSVLDSLLLELKKEGYVPQLYLP 750 Query: 181 MHPQIM 198 MHPQ++ Sbjct: 751 MHPQLL 756 >ref|XP_004503357.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Cicer arietinum] Length = 875 Score = 107 bits (267), Expect = 2e-21 Identities = 47/66 (71%), Positives = 58/66 (87%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK++GV+K+PGYSWI++ THMF AAD SHP+S EIY +LK+LL ELRK+GYVPQPYLP Sbjct: 807 MKEKGVQKIPGYSWIDVIGGTHMFSAADGSHPQSDEIYLILKSLLLELRKQGYVPQPYLP 866 Query: 181 MHPQIM 198 +HPQIM Sbjct: 867 LHPQIM 872 >ref|XP_003547574.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] Length = 846 Score = 107 bits (266), Expect = 2e-21 Identities = 45/67 (67%), Positives = 58/67 (86%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK++GV+K+PGYSWI++N THMF AA+ +HP+S EIY +L +LL ELRK+GYVPQPYLP Sbjct: 778 MKEKGVQKIPGYSWIDVNGGTHMFSAAEGNHPESVEIYLILNSLLLELRKQGYVPQPYLP 837 Query: 181 MHPQIMG 201 +HPQI G Sbjct: 838 LHPQITG 844 >ref|XP_006468372.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Citrus sinensis] Length = 847 Score = 103 bits (258), Expect = 2e-20 Identities = 47/68 (69%), Positives = 57/68 (83%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+RGV+K+PGYSWIELN+ TH+FVAAD SH +SA+IY LL LLPEL KEGY+PQP L Sbjct: 780 MKERGVQKIPGYSWIELNNITHLFVAADESHSESAQIYSLLNILLPELEKEGYIPQPCLS 839 Query: 181 MHPQIMGV 204 MH Q +G+ Sbjct: 840 MHLQALGM 847 >ref|NP_193861.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207660|sp|Q9STE1.1|PP333_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g21300 gi|3402749|emb|CAA20195.1| putative protein [Arabidopsis thaliana] gi|7268926|emb|CAB79129.1| putative protein [Arabidopsis thaliana] gi|332659037|gb|AEE84437.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 857 Score = 100 bits (250), Expect = 2e-19 Identities = 43/72 (59%), Positives = 57/72 (79%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+R V+K+PGYSWIE+N TH+FV+ D +HP+S+ IY LL +LL ELR EGY+PQPYLP Sbjct: 772 MKEREVQKIPGYSWIEINKRTHLFVSGDVNHPESSHIYSLLNSLLGELRLEGYIPQPYLP 831 Query: 181 MHPQIMGVQYPM 216 +HP+ YP+ Sbjct: 832 LHPESSRKVYPV 843 >ref|XP_006286154.1| hypothetical protein CARUB_v10007713mg [Capsella rubella] gi|482554859|gb|EOA19052.1| hypothetical protein CARUB_v10007713mg [Capsella rubella] Length = 854 Score = 99.0 bits (245), Expect = 6e-19 Identities = 40/64 (62%), Positives = 53/64 (82%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+RGV+K+PGYSW+E+N TH+FV+ D +HP S+ IY L+ LL ELR EGY+PQPYLP Sbjct: 771 MKERGVQKIPGYSWVEINKVTHLFVSGDVNHPNSSHIYSLVNLLLEELRLEGYIPQPYLP 830 Query: 181 MHPQ 192 +HP+ Sbjct: 831 LHPE 834 >ref|XP_002869895.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315731|gb|EFH46154.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 853 Score = 99.0 bits (245), Expect = 6e-19 Identities = 41/64 (64%), Positives = 54/64 (84%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGYVPQPYLP 180 MK+R V+K+PGYSWIE+N TH+FV+ D +HP+S+ IY LL +LL ELR EGY+PQPYLP Sbjct: 768 MKEREVQKIPGYSWIEINKITHLFVSGDVNHPESSHIYSLLNSLLEELRLEGYIPQPYLP 827 Query: 181 MHPQ 192 +HP+ Sbjct: 828 LHPE 831 >ref|XP_006448816.1| hypothetical protein CICLE_v10014257mg [Citrus clementina] gi|557551427|gb|ESR62056.1| hypothetical protein CICLE_v10014257mg [Citrus clementina] Length = 848 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/69 (63%), Positives = 57/69 (82%), Gaps = 1/69 (1%) Frame = +1 Query: 1 MKDRGVKKVPGYSWIELNSTTHMFVAADSSHPKSAEIYFLLKNLLPELRKEGY-VPQPYL 177 MK+RGV+K+PGYSWIE+N+ T++FVAAD SH +SA+IY LL LLP+L KEGY +PQP L Sbjct: 780 MKERGVQKIPGYSWIEVNNRTYLFVAADESHSESAQIYSLLNILLPDLEKEGYNIPQPCL 839 Query: 178 PMHPQIMGV 204 MH Q +G+ Sbjct: 840 SMHLQTLGL 848