BLASTX nr result
ID: Paeonia24_contig00040452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00040452 (265 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213256.1| hypothetical protein PRUPE_ppb020741mg [Prun... 55 8e-06 >ref|XP_007213256.1| hypothetical protein PRUPE_ppb020741mg [Prunus persica] gi|462409121|gb|EMJ14455.1| hypothetical protein PRUPE_ppb020741mg [Prunus persica] Length = 707 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/66 (42%), Positives = 41/66 (62%) Frame = -1 Query: 205 SEEIRDVPRPPKLKIKIPDFIMFDRMVDPVEHTFTFQQKLNL*EDDEALQCRVFPSILKR 26 +E+I +P +K P F +F+ DP+EH + FQQ++ L DDEAL C++FPS L Sbjct: 229 TEDILKAKKP--VKFTQPKFKLFEGTTDPIEHIYHFQQQMVLEGDDEALLCKLFPSSLSG 286 Query: 25 GALVCF 8 AL+ F Sbjct: 287 SALIWF 292