BLASTX nr result
ID: Paeonia24_contig00040352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00040352 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305455.1| PREDICTED: F-box protein At3g07870-like [Fra... 88 1e-15 ref|XP_007216110.1| hypothetical protein PRUPE_ppa018725mg [Prun... 84 2e-14 ref|XP_007217507.1| hypothetical protein PRUPE_ppa025214mg [Prun... 82 6e-14 ref|XP_006352955.1| PREDICTED: F-box protein At3g07870-like [Sol... 80 2e-13 ref|XP_004243873.1| PREDICTED: F-box protein CPR30-like [Solanum... 80 4e-13 ref|XP_007021323.1| F-box and associated interaction domains-con... 78 1e-12 ref|XP_002316906.2| hypothetical protein POPTR_0011s12180g [Popu... 75 9e-12 ref|XP_002527480.1| conserved hypothetical protein [Ricinus comm... 74 3e-11 ref|XP_007219356.1| hypothetical protein PRUPE_ppa019474mg, part... 73 4e-11 ref|XP_004296140.1| PREDICTED: F-box protein CPR30-like [Fragari... 73 5e-11 ref|XP_007211487.1| hypothetical protein PRUPE_ppa007670mg [Prun... 73 5e-11 ref|XP_006348865.1| PREDICTED: F-box protein At3g07870-like isof... 71 1e-10 ref|XP_006348862.1| PREDICTED: F-box protein At3g07870-like isof... 71 1e-10 ref|XP_004243292.1| PREDICTED: F-box protein At3g07870-like [Sol... 71 2e-10 ref|XP_004140235.1| PREDICTED: F-box protein CPR30-like [Cucumis... 70 4e-10 ref|XP_004301954.1| PREDICTED: F-box protein CPR30-like [Fragari... 69 5e-10 ref|XP_007021319.1| Uncharacterized protein TCM_031358 [Theobrom... 69 7e-10 ref|XP_004288378.1| PREDICTED: F-box/kelch-repeat protein At3g23... 69 7e-10 ref|XP_007219353.1| hypothetical protein PRUPE_ppa019459mg, part... 69 9e-10 ref|XP_004295995.1| PREDICTED: F-box protein CPR30-like [Fragari... 68 1e-09 >ref|XP_004305455.1| PREDICTED: F-box protein At3g07870-like [Fragaria vesca subsp. vesca] Length = 373 Score = 87.8 bits (216), Expect = 1e-15 Identities = 47/93 (50%), Positives = 59/93 (63%) Frame = +3 Query: 12 TLKTMVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINN 191 ++K DYLPEE+ E+L +LPIKS++Q VCKSW SLI FI +HL LT + I Sbjct: 2 SMKFSSDYLPEEMMIEILLRLPIKSLLQFTSVCKSWNSLIKGNTFIKNHLKLT-TKRITR 60 Query: 192 RSHLLLLRHYPENQNEEQYSLRCISNTFDNYSE 290 LLLLRH P N EQYSL ++TF YS+ Sbjct: 61 DGPLLLLRHCPSEPNVEQYSLHLDNHTFQEYSK 93 >ref|XP_007216110.1| hypothetical protein PRUPE_ppa018725mg [Prunus persica] gi|462412260|gb|EMJ17309.1| hypothetical protein PRUPE_ppa018725mg [Prunus persica] Length = 383 Score = 84.0 bits (206), Expect = 2e-14 Identities = 42/89 (47%), Positives = 58/89 (65%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M +YLP E+ T++L +LPIKS++QC +CKSW SLI + FI +HLNL N S L Sbjct: 1 MSEYLPPEIITQILLRLPIKSLLQCTSICKSWNSLIKHTRFINNHLNLNLDKTSN--SPL 58 Query: 204 LLLRHYPENQNEEQYSLRCISNTFDNYSE 290 LLLRH P++ E YSL + +F +S+ Sbjct: 59 LLLRHCPKDPTRELYSLHLDNGSFQEHSK 87 >ref|XP_007217507.1| hypothetical protein PRUPE_ppa025214mg [Prunus persica] gi|462413657|gb|EMJ18706.1| hypothetical protein PRUPE_ppa025214mg [Prunus persica] Length = 373 Score = 82.4 bits (202), Expect = 6e-14 Identities = 41/89 (46%), Positives = 58/89 (65%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M +YLP E+ T++L +LPIKS+++C +CKSW SLI + FI +HLNL N S L Sbjct: 1 MSEYLPPEIITQILLRLPIKSLLRCTSICKSWNSLIKHTRFINNHLNLNLDKTSN--SPL 58 Query: 204 LLLRHYPENQNEEQYSLRCISNTFDNYSE 290 LLLRH P++ E YSL + +F +S+ Sbjct: 59 LLLRHCPKDPTRELYSLHLDNGSFQEHSK 87 >ref|XP_006352955.1| PREDICTED: F-box protein At3g07870-like [Solanum tuberosum] Length = 413 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/87 (47%), Positives = 53/87 (60%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M +YLP+EV E+ +LP KS++QC VCKSWYSLIT+P FI+ HLN N N Sbjct: 1 MSEYLPQEVLIEIFLRLPTKSLIQCTSVCKSWYSLITSPNFISIHLN-----NNNKDDDY 55 Query: 204 LLLRHYPENQNEEQYSLRCISNTFDNY 284 L+RH E +E Y+L + FD Y Sbjct: 56 SLVRHCSEEPVKEMYALFYDNENFDQY 82 >ref|XP_004243873.1| PREDICTED: F-box protein CPR30-like [Solanum lycopersicum] Length = 485 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/77 (51%), Positives = 51/77 (66%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M DYLP++V E+L KLP+K++VQC VCKSWYS+I NP FI+ H N ST R L Sbjct: 1 MSDYLPKDVLVEILSKLPLKTLVQCTTVCKSWYSIIINPNFISLHHNTHIST--AGRRPL 58 Query: 204 LLLRHYPENQNEEQYSL 254 L +RHY E+Y+L Sbjct: 59 LFVRHYNMFDRVERYAL 75 >ref|XP_007021323.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590608658|ref|XP_007021324.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590608661|ref|XP_007021325.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508720951|gb|EOY12848.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508720952|gb|EOY12849.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508720953|gb|EOY12850.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 398 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/89 (46%), Positives = 56/89 (62%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M DYLP+EV E+L +LP+KS+V+C VCK+W SLI +P FI+SHL S HL Sbjct: 1 MSDYLPQEVILEILRRLPVKSLVKCRSVCKAWNSLIKSPSFISSHLQTALS---KPNDHL 57 Query: 204 LLLRHYPENQNEEQYSLRCISNTFDNYSE 290 LLLR + ++E Y L ++ FD Y + Sbjct: 58 LLLRLF--ENDKESYFLHFDNDDFDEYKQ 84 >ref|XP_002316906.2| hypothetical protein POPTR_0011s12180g [Populus trichocarpa] gi|550328210|gb|EEE97518.2| hypothetical protein POPTR_0011s12180g [Populus trichocarpa] Length = 381 Score = 75.1 bits (183), Expect = 9e-12 Identities = 41/89 (46%), Positives = 57/89 (64%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M DYL E++ E+L KLPIKS+++C +CKSW SLI +P FI HL T S+ +R +L Sbjct: 1 MSDYLSEDLIQEILYKLPIKSLLRCTSLCKSWNSLIKSPTFIFKHLQHTISS--TDRQNL 58 Query: 204 LLLRHYPENQNEEQYSLRCISNTFDNYSE 290 LLR + EEQYSLR + F+ + + Sbjct: 59 FLLR-LCSREREEQYSLRLDNQDFNEHMQ 86 >ref|XP_002527480.1| conserved hypothetical protein [Ricinus communis] gi|223533120|gb|EEF34878.1| conserved hypothetical protein [Ricinus communis] Length = 379 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/90 (37%), Positives = 58/90 (64%), Gaps = 1/90 (1%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M+D++P+EV ++ +LP+K +++C +CK+WYSLI+N FI++H T +N NN Sbjct: 1 MLDHIPKEVLIKIFLRLPVKQLLRCRCICKTWYSLISNHNFISTHSRYTIDSNNNN---Y 57 Query: 204 LLLRHYPENQNEEQYSLRC-ISNTFDNYSE 290 L+LRHY + +E+++L + F Y E Sbjct: 58 LILRHYSRSNKKERFALHFDDDDMFSEYQE 87 >ref|XP_007219356.1| hypothetical protein PRUPE_ppa019474mg, partial [Prunus persica] gi|462415818|gb|EMJ20555.1| hypothetical protein PRUPE_ppa019474mg, partial [Prunus persica] Length = 184 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/84 (44%), Positives = 52/84 (61%) Frame = +3 Query: 39 PEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHLLLLRH 218 P+E+ E+L +L +KS+++C VCK+W S+I N FI +HLN T N N SHL L+ H Sbjct: 14 PQEIIQEILLRLTVKSVIKCISVCKTWRSMIINQSFIRTHLNPTVHVNNLNASHLFLI-H 72 Query: 219 YPENQNEEQYSLRCISNTFDNYSE 290 + EE YSL + FD YS+ Sbjct: 73 RVADVLEEVYSLHYDNKAFDEYSK 96 >ref|XP_004296140.1| PREDICTED: F-box protein CPR30-like [Fragaria vesca subsp. vesca] Length = 414 Score = 72.8 bits (177), Expect = 5e-11 Identities = 41/102 (40%), Positives = 57/102 (55%), Gaps = 13/102 (12%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M DYLP+EV T +L +LPIKS+V C VCKSW S+I + FI +HL+ T N ++ +HL Sbjct: 1 MSDYLPQEVITNILLRLPIKSLVICTSVCKSWMSMIKDSSFIGAHLSRTIDFNNHHGTHL 60 Query: 204 LLLRHYPENQ-------------NEEQYSLRCISNTFDNYSE 290 LLL + E+ YSL ++ FD+ E Sbjct: 61 LLLHRFSSKNCGIRGRNSSVPGVKEDVYSLHYDNSGFDDCCE 102 >ref|XP_007211487.1| hypothetical protein PRUPE_ppa007670mg [Prunus persica] gi|462407352|gb|EMJ12686.1| hypothetical protein PRUPE_ppa007670mg [Prunus persica] Length = 360 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/79 (46%), Positives = 49/79 (62%), Gaps = 1/79 (1%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLT-KSTNINNRSH 200 M DY P+++ E+L +LP K +++C VCK W SLI +P FI SHL T S N + Sbjct: 1 MSDYFPKDIIQEILQRLPTKCLIKCTLVCKPWRSLIQSPSFIHSHLRRTIHSNNQDAAVG 60 Query: 201 LLLLRHYPENQNEEQYSLR 257 LLLLR + N+N YSLR Sbjct: 61 LLLLRAFAGNENSALYSLR 79 >ref|XP_006348865.1| PREDICTED: F-box protein At3g07870-like isoform X4 [Solanum tuberosum] Length = 397 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/69 (47%), Positives = 46/69 (66%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M DYLPEE+ ++ KLP+KSI++C VCKSWYSL+T+P F +HLN R Sbjct: 1 MSDYLPEELLLDIFTKLPVKSILRCRSVCKSWYSLLTSPSFTFTHLN-------RKRDDH 53 Query: 204 LLLRHYPEN 230 +L+R+Y +N Sbjct: 54 MLIRNYAKN 62 >ref|XP_006348862.1| PREDICTED: F-box protein At3g07870-like isoform X1 [Solanum tuberosum] gi|565364298|ref|XP_006348863.1| PREDICTED: F-box protein At3g07870-like isoform X2 [Solanum tuberosum] gi|565364300|ref|XP_006348864.1| PREDICTED: F-box protein At3g07870-like isoform X3 [Solanum tuberosum] Length = 464 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/69 (47%), Positives = 46/69 (66%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M DYLPEE+ ++ KLP+KSI++C VCKSWYSL+T+P F +HLN R Sbjct: 1 MSDYLPEELLLDIFTKLPVKSILRCRSVCKSWYSLLTSPSFTFTHLN-------RKRDDH 53 Query: 204 LLLRHYPEN 230 +L+R+Y +N Sbjct: 54 MLIRNYAKN 62 >ref|XP_004243292.1| PREDICTED: F-box protein At3g07870-like [Solanum lycopersicum] Length = 455 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/77 (42%), Positives = 48/77 (62%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M DYLP+E+ ++ KLP+KSI++C VCKSWYSL+T+P F +HLN R Sbjct: 1 MSDYLPQELLVDIFTKLPVKSILRCRSVCKSWYSLLTSPSFTFTHLN-------RKRDDH 53 Query: 204 LLLRHYPENQNEEQYSL 254 +L+R+Y + + Y L Sbjct: 54 MLIRNYGRSTRLDMYPL 70 >ref|XP_004140235.1| PREDICTED: F-box protein CPR30-like [Cucumis sativus] gi|449511918|ref|XP_004164088.1| PREDICTED: F-box protein CPR30-like [Cucumis sativus] Length = 391 Score = 69.7 bits (169), Expect = 4e-10 Identities = 37/91 (40%), Positives = 54/91 (59%), Gaps = 2/91 (2%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M+D LP E+ + KLP ++++ C V K W SLIT+P F+ SHLN + + + NR+ L Sbjct: 1 MLDSLPPEILFYIFLKLPSRTLILCTCVSKPWRSLITDPAFLLSHLNQSNTNHHRNRNRL 60 Query: 204 LLLR--HYPENQNEEQYSLRCISNTFDNYSE 290 LLLR + + E+YSL S+T Y E Sbjct: 61 LLLRRCYSTATKKAERYSLHFDSDTLGIYKE 91 >ref|XP_004301954.1| PREDICTED: F-box protein CPR30-like [Fragaria vesca subsp. vesca] Length = 426 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/102 (36%), Positives = 56/102 (54%), Gaps = 13/102 (12%) Frame = +3 Query: 18 KTMVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRS 197 K ++ P+E+ +VL +LPIK +V+C VCKSW ++I +P FI +HL +S N N + Sbjct: 26 KNLIKDFPQELIHDVLIRLPIKPLVKCTSVCKSWRTIIKDPTFILTHLTHKRSFNTQNAT 85 Query: 198 HLLLL-------------RHYPENQNEEQYSLRCISNTFDNY 284 HLLLL + + E E+ YSL ++ F Y Sbjct: 86 HLLLLHTVFGEDLYHVLGKPHVEGFKEDLYSLHYDNSAFGEY 127 >ref|XP_007021319.1| Uncharacterized protein TCM_031358 [Theobroma cacao] gi|508720947|gb|EOY12844.1| Uncharacterized protein TCM_031358 [Theobroma cacao] Length = 349 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/84 (40%), Positives = 53/84 (63%), Gaps = 2/84 (2%) Frame = +3 Query: 33 YLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLN--LTKSTNINNRSHLL 206 YLPEE+F ++ LP+KS+ +C VCK+W LI NP FI++HLN L KS+ N+ + L Sbjct: 51 YLPEEIFLQIFRNLPVKSLGKCMCVCKAWNCLIKNPSFISTHLNKQLEKSSRNNSDNLFL 110 Query: 207 LLRHYPENQNEEQYSLRCISNTFD 278 ++ P N+ + +Y L+ F+ Sbjct: 111 VMSRDPGNEFKMRYFLQFDDQEFN 134 >ref|XP_004288378.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Fragaria vesca subsp. vesca] Length = 163 Score = 68.9 bits (167), Expect = 7e-10 Identities = 39/90 (43%), Positives = 53/90 (58%), Gaps = 2/90 (2%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHL 203 M D+LP+E+ +L LP+KS+++ VCKSW SLI P FI SHL+ T +N SHL Sbjct: 1 MSDFLPQEIIHRILLHLPVKSLIRSTLVCKSWKSLIKCPDFIESHLSTTIVSNDEKDSHL 60 Query: 204 LLLRHYPE--NQNEEQYSLRCISNTFDNYS 287 LLL E + + +SLR S F +S Sbjct: 61 LLLSASSEDGHTRHQHHSLRWDSPEFGAHS 90 >ref|XP_007219353.1| hypothetical protein PRUPE_ppa019459mg, partial [Prunus persica] gi|462415815|gb|EMJ20552.1| hypothetical protein PRUPE_ppa019459mg, partial [Prunus persica] Length = 299 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/97 (38%), Positives = 52/97 (53%), Gaps = 13/97 (13%) Frame = +3 Query: 39 PEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSHLLLLRH 218 P+E+ E+L +L +KS+++C VCK+W S+I N FI +HLN T N N SHL L+ Sbjct: 24 PQEIIQEILLRLTVKSVIKCISVCKTWRSMIINQSFIRTHLNPTVHVNNLNASHLFLIHR 83 Query: 219 YP-------------ENQNEEQYSLRCISNTFDNYSE 290 E+ EE YSL + FD YS+ Sbjct: 84 VAGKRSVTMFHKALVEDVLEEVYSLHYDNKAFDEYSK 120 >ref|XP_004295995.1| PREDICTED: F-box protein CPR30-like [Fragaria vesca subsp. vesca] Length = 373 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/78 (44%), Positives = 48/78 (61%), Gaps = 1/78 (1%) Frame = +3 Query: 24 MVDYLPEEVFTEVLGKLPIKSIVQCAFVCKSWYSLITNPIFITSHLNLTKSTNINNRSH- 200 M DY+PE+V ++L KLPIKS+++C VC SW +LI + FI SHL + N +H Sbjct: 1 MSDYIPEDVVNKILLKLPIKSLMRCRVVCHSWNNLIKSSTFINSHLCSISQLHSENEAHD 60 Query: 201 LLLLRHYPENQNEEQYSL 254 LLLL+ Y + YSL Sbjct: 61 LLLLQGYADENGPVIYSL 78