BLASTX nr result
ID: Paeonia24_contig00040192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00040192 (407 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein... 59 9e-07 ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily p... 59 9e-07 ref|XP_006379222.1| hypothetical protein POPTR_0009s11220g, part... 57 3e-06 ref|XP_006297214.1| hypothetical protein CARUB_v10013223mg [Caps... 57 3e-06 >ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] gi|508705300|gb|EOX97196.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] Length = 494 Score = 58.5 bits (140), Expect = 9e-07 Identities = 36/99 (36%), Positives = 51/99 (51%) Frame = +1 Query: 109 NMKIPKHKAVGLQTFKQKKLSTLFKTKHXXXXXXXXXXXXXKVSPEMPKAPTYNTPITER 288 NMK HK + Q K+KKL T+ + + T ++ I+ Sbjct: 15 NMKA--HKVLSSQILKRKKLKTVIPHSSALCSSTSQLVTSDQ-------SQTASSQISPE 65 Query: 289 FIHDSVLSSQWHLIKHVSTRIDPSLISNTLHNLHKTPDL 405 + +SV SSQWH IKH S+ ++PS+IS L NLHKTP+L Sbjct: 66 LLIESVRSSQWHFIKHQSSDLNPSVISTVLLNLHKTPEL 104 >ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682507|ref|XP_007041361.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682510|ref|XP_007041362.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682513|ref|XP_007041363.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682516|ref|XP_007041364.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682524|ref|XP_007041366.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705295|gb|EOX97191.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705296|gb|EOX97192.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705297|gb|EOX97193.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705298|gb|EOX97194.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705299|gb|EOX97195.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705301|gb|EOX97197.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 650 Score = 58.5 bits (140), Expect = 9e-07 Identities = 36/99 (36%), Positives = 51/99 (51%) Frame = +1 Query: 109 NMKIPKHKAVGLQTFKQKKLSTLFKTKHXXXXXXXXXXXXXKVSPEMPKAPTYNTPITER 288 NMK HK + Q K+KKL T+ + + T ++ I+ Sbjct: 15 NMKA--HKVLSSQILKRKKLKTVIPHSSALCSSTSQLVTSDQ-------SQTASSQISPE 65 Query: 289 FIHDSVLSSQWHLIKHVSTRIDPSLISNTLHNLHKTPDL 405 + +SV SSQWH IKH S+ ++PS+IS L NLHKTP+L Sbjct: 66 LLIESVRSSQWHFIKHQSSDLNPSVISTVLLNLHKTPEL 104 >ref|XP_006379222.1| hypothetical protein POPTR_0009s11220g, partial [Populus trichocarpa] gi|550331503|gb|ERP57019.1| hypothetical protein POPTR_0009s11220g, partial [Populus trichocarpa] Length = 451 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/57 (47%), Positives = 41/57 (71%), Gaps = 2/57 (3%) Frame = +1 Query: 241 PEMPKAPTYNT--PITERFIHDSVLSSQWHLIKHVSTRIDPSLISNTLHNLHKTPDL 405 P +P + + ++ P++ + I +S+ SSQWH +KH + +I PSLIS T+ NLHKTPDL Sbjct: 1 PTIPNSVSKHSQRPLSPQKILNSMHSSQWHFVKHFAPKITPSLISTTIINLHKTPDL 57 >ref|XP_006297214.1| hypothetical protein CARUB_v10013223mg [Capsella rubella] gi|482565923|gb|EOA30112.1| hypothetical protein CARUB_v10013223mg [Capsella rubella] Length = 623 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +1 Query: 274 PITERFIHDSVLSSQWHLIKHVSTRIDPSLISNTLHNLHKTPDL 405 PIT + DS+ SSQWH+++H+S + PSL+S TL NL KTPDL Sbjct: 40 PITSDILLDSIKSSQWHIVEHLSDKFTPSLLSTTLLNLVKTPDL 83