BLASTX nr result
ID: Paeonia24_contig00040138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00040138 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006481498.1| PREDICTED: putative cyclic nucleotide-gated ... 81 2e-13 ref|XP_006428772.1| hypothetical protein CICLE_v10011188mg [Citr... 81 2e-13 ref|XP_007027345.1| Cyclic nucleotide-gated channel 15 isoform 2... 75 9e-12 ref|XP_007027344.1| Cyclic nucleotide-gated channel 15 isoform 1... 75 9e-12 ref|XP_002282455.1| PREDICTED: putative cyclic nucleotide-gated ... 59 5e-07 emb|CAN61379.1| hypothetical protein VITISV_037545 [Vitis vinifera] 59 5e-07 ref|XP_007016780.1| Cyclic nucleotide-gated channel 15 [Theobrom... 58 1e-06 ref|XP_004291702.1| PREDICTED: putative cyclic nucleotide-gated ... 58 2e-06 ref|XP_002314283.1| cyclic nucleotide-gated ion channel 15 famil... 56 6e-06 ref|XP_007208333.1| hypothetical protein PRUPE_ppa002211mg [Prun... 55 8e-06 >ref|XP_006481498.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Citrus sinensis] Length = 710 Score = 80.9 bits (198), Expect = 2e-13 Identities = 41/69 (59%), Positives = 51/69 (73%), Gaps = 1/69 (1%) Frame = +2 Query: 2 KSAVASLSELTLEQKRSSMVPLGSG-LSGYAAKLAASVRRGGSKKCGSEYDILDSLQKPV 178 + + S+S+ +QK +S GSG + YAAKLAAS RRGGSK+CG+E+DIL SLQKP Sbjct: 642 REGMISMSDQATDQKEASSPSTGSGQFTSYAAKLAASTRRGGSKRCGTEFDILSSLQKPN 701 Query: 179 EPDFTVDDR 205 EPDFTV DR Sbjct: 702 EPDFTVVDR 710 >ref|XP_006428772.1| hypothetical protein CICLE_v10011188mg [Citrus clementina] gi|557530829|gb|ESR42012.1| hypothetical protein CICLE_v10011188mg [Citrus clementina] Length = 710 Score = 80.9 bits (198), Expect = 2e-13 Identities = 41/69 (59%), Positives = 51/69 (73%), Gaps = 1/69 (1%) Frame = +2 Query: 2 KSAVASLSELTLEQKRSSMVPLGSG-LSGYAAKLAASVRRGGSKKCGSEYDILDSLQKPV 178 + + S+S+ +QK +S GSG + YAAKLAAS RRGGSK+CG+E+DIL SLQKP Sbjct: 642 REGMISMSDQATDQKEASSPSTGSGQFTSYAAKLAASTRRGGSKRCGTEFDILSSLQKPN 701 Query: 179 EPDFTVDDR 205 EPDFTV DR Sbjct: 702 EPDFTVVDR 710 >ref|XP_007027345.1| Cyclic nucleotide-gated channel 15 isoform 2 [Theobroma cacao] gi|508715950|gb|EOY07847.1| Cyclic nucleotide-gated channel 15 isoform 2 [Theobroma cacao] Length = 681 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 2/70 (2%) Frame = +2 Query: 2 KSAVASLSELTLEQKRS-SMVPLGSGLSGYAAKLAASVR-RGGSKKCGSEYDILDSLQKP 175 +S AS E EQ + ++ P+ SG + YAAKLAAS R RGGS++CG+++DIL SLQKP Sbjct: 612 ESMAASSPEQATEQTGAPALPPVASGFASYAAKLAASTRSRGGSRRCGTDFDILGSLQKP 671 Query: 176 VEPDFTVDDR 205 EPDFTV+DR Sbjct: 672 NEPDFTVEDR 681 >ref|XP_007027344.1| Cyclic nucleotide-gated channel 15 isoform 1 [Theobroma cacao] gi|508715949|gb|EOY07846.1| Cyclic nucleotide-gated channel 15 isoform 1 [Theobroma cacao] Length = 712 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 2/70 (2%) Frame = +2 Query: 2 KSAVASLSELTLEQKRS-SMVPLGSGLSGYAAKLAASVR-RGGSKKCGSEYDILDSLQKP 175 +S AS E EQ + ++ P+ SG + YAAKLAAS R RGGS++CG+++DIL SLQKP Sbjct: 643 ESMAASSPEQATEQTGAPALPPVASGFASYAAKLAASTRSRGGSRRCGTDFDILGSLQKP 702 Query: 176 VEPDFTVDDR 205 EPDFTV+DR Sbjct: 703 NEPDFTVEDR 712 >ref|XP_002282455.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Vitis vinifera] Length = 713 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 68 GSGLSGYAAKLAASVRRGGSKKCGSEYDILDSLQKPVEPDFTVDD 202 GSGL+ YAA+LAAS RRG K GS+ ++ SLQKP EPDF+VD+ Sbjct: 668 GSGLAVYAARLAASARRGPLKHSGSDSSVVSSLQKPAEPDFSVDE 712 >emb|CAN61379.1| hypothetical protein VITISV_037545 [Vitis vinifera] Length = 650 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 68 GSGLSGYAAKLAASVRRGGSKKCGSEYDILDSLQKPVEPDFTVDD 202 GSGL+ YAA+LAAS RRG K GS+ ++ SLQKP EPDF+VD+ Sbjct: 605 GSGLAVYAARLAASARRGPLKHSGSDSSVVSSLQKPAEPDFSVDE 649 >ref|XP_007016780.1| Cyclic nucleotide-gated channel 15 [Theobroma cacao] gi|508787143|gb|EOY34399.1| Cyclic nucleotide-gated channel 15 [Theobroma cacao] Length = 708 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +2 Query: 68 GSGLSGYAAKLAASVRRGGSKKCGSEYDILDSLQKPVEPDFTVDD 202 GSGL+ YAA+LAAS RRG + CGS+ ++ SL+KP EPDF+VD+ Sbjct: 663 GSGLAMYAARLAASNRRGVNLHCGSDSGVVSSLRKPAEPDFSVDE 707 >ref|XP_004291702.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Fragaria vesca subsp. vesca] Length = 704 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 71 SGLSGYAAKLAASVRRGGSKKCGSEYDILDSLQKPVEPDFTVDD 202 SGL+ YAA+LAAS RRG K GS+ ++ SLQKP EPDF+VD+ Sbjct: 660 SGLATYAARLAASTRRGAKKHPGSDSGVVSSLQKPAEPDFSVDE 703 >ref|XP_002314283.1| cyclic nucleotide-gated ion channel 15 family protein [Populus trichocarpa] gi|222850691|gb|EEE88238.1| cyclic nucleotide-gated ion channel 15 family protein [Populus trichocarpa] Length = 745 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +2 Query: 68 GSGLSGYAAKLAASVRRGGSKKCGSEYDILDSLQKPVEPDFTVDD 202 GS LS YAA+L AS RRG K+ GS+ ++ SLQKP EPDF+VD+ Sbjct: 700 GSSLSMYAARLKASARRGVLKRSGSDSSVVSSLQKPDEPDFSVDE 744 >ref|XP_007208333.1| hypothetical protein PRUPE_ppa002211mg [Prunus persica] gi|462403975|gb|EMJ09532.1| hypothetical protein PRUPE_ppa002211mg [Prunus persica] Length = 700 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +2 Query: 62 PLGSGLSGYAAKLAASVRRGGSKKCGSEYDILDSLQKPVEPDFTVDD 202 P S L YAA+LAAS RRG +K GS+ ++ SLQKP EPDF+VD+ Sbjct: 653 PPVSSLVTYAARLAASTRRGANKHSGSDSGVVTSLQKPAEPDFSVDE 699