BLASTX nr result
ID: Paeonia24_contig00040074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00040074 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA33396.1| light-harvesting chlorophyll a/b protein precurso... 150 2e-34 sp|P12333.1|CB2A_SPIOL RecName: Full=Chlorophyll a-b binding pro... 148 7e-34 ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245... 148 7e-34 ref|XP_004234063.1| PREDICTED: chlorophyll a-b binding protein 3... 147 1e-33 ref|XP_004234062.1| PREDICTED: chlorophyll a-b binding protein 3... 147 1e-33 ref|XP_004234058.1| PREDICTED: chlorophyll a-b binding protein 3... 147 1e-33 gb|AFO67221.1| putative chlorophyll a/b binding protein, partial... 147 1e-33 sp|P27495.1|CB24_TOBAC RecName: Full=Chlorophyll a-b binding pro... 146 3e-33 gb|AAB87573.1| chlorophyll a/b binding protein of LHCII type I p... 145 4e-33 ref|NP_565786.1| photosystem II light harvesting complex protein... 145 6e-33 ref|XP_006295385.1| hypothetical protein CARUB_v10024479mg [Caps... 145 7e-33 dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein... 145 7e-33 ref|NP_564339.1| chlorophyll A/B binding protein 3 [Arabidopsis ... 144 1e-32 sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding pro... 144 1e-32 ref|NP_174286.1| chlorophyll A/B binding protein 1 [Arabidopsis ... 144 1e-32 ref|XP_002890838.1| hypothetical protein ARALYDRAFT_473204 [Arab... 144 1e-32 gb|AAL38341.1| chlorophyll a/b-binding protein [Arabidopsis thal... 144 1e-32 dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein... 144 1e-32 gb|AAT08668.1| chloroplast chlorophyll A-B binding protein 40 [H... 144 1e-32 dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein... 144 2e-32 >gb|AAA33396.1| light-harvesting chlorophyll a/b protein precursor [Lemna gibba] Length = 266 Score = 150 bits (378), Expect = 2e-34 Identities = 73/84 (86%), Positives = 77/84 (91%), Gaps = 3/84 (3%) Frame = +3 Query: 78 GKA--LVPSSSEVFGEGRISMRKTTAKPKTVSS-SPWYGPDRVKYLGPFSGESPSYLTGE 248 GKA L P++SEVFGEGR+SMRKT KPK VSS SPWYGPDRVKYLGPFSGE+PSYLTGE Sbjct: 14 GKAVKLAPAASEVFGEGRVSMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE 73 Query: 249 FAGDYGWDTAGLSADPETFAKNRE 320 FAGDYGWDTAGLSADPETFAKNRE Sbjct: 74 FAGDYGWDTAGLSADPETFAKNRE 97 >sp|P12333.1|CB2A_SPIOL RecName: Full=Chlorophyll a-b binding protein, chloroplastic; AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor gi|14240|emb|CAA32526.1| chlorophyll a/b binding protein precursor [Spinacia oleracea] gi|193783447|emb|CAJ77389.3| major chlorophyll a/b binding protein LHCb1.3 [Spinacia oleracea] Length = 267 Score = 148 bits (374), Expect = 7e-34 Identities = 73/85 (85%), Positives = 77/85 (90%), Gaps = 3/85 (3%) Frame = +3 Query: 75 AGKA--LVPSSSEVFGEGRISMRKTTAKPKTV-SSSPWYGPDRVKYLGPFSGESPSYLTG 245 AGKA L P++SE+ GEGRI+MRKT KPKTV SSSPWYGPDRVKYLGPFSGESPSYLTG Sbjct: 14 AGKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTG 73 Query: 246 EFAGDYGWDTAGLSADPETFAKNRE 320 EF GDYGWDTAGLSADPETFAKNRE Sbjct: 74 EFPGDYGWDTAGLSADPETFAKNRE 98 >ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245729 [Solanum lycopersicum] Length = 554 Score = 148 bits (374), Expect = 7e-34 Identities = 74/86 (86%), Positives = 76/86 (88%), Gaps = 3/86 (3%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSS-SPWYGPDRVKYLGPFSGESPSYLT 242 FAGKA L PSSSE+ G GRI+MRKT AKPK SS SPWYGPDRVKYLGPFSGESPSYLT Sbjct: 13 FAGKAVKLSPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLT 72 Query: 243 GEFAGDYGWDTAGLSADPETFAKNRE 320 GEF GDYGWDTAGLSADPETFAKNRE Sbjct: 73 GEFPGDYGWDTAGLSADPETFAKNRE 98 Score = 143 bits (361), Expect = 2e-32 Identities = 71/86 (82%), Positives = 74/86 (86%), Gaps = 3/86 (3%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSS-SPWYGPDRVKYLGPFSGESPSYLT 242 FAGKA L PSSSE+ G GR++MRKT K K SS SPWYGPDRVKYLGPFSGESPSYLT Sbjct: 300 FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLT 359 Query: 243 GEFAGDYGWDTAGLSADPETFAKNRE 320 GEF GDYGWDTAGLSADPETFAKNRE Sbjct: 360 GEFPGDYGWDTAGLSADPETFAKNRE 385 >ref|XP_004234063.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 6 [Solanum lycopersicum] Length = 244 Score = 147 bits (372), Expect = 1e-33 Identities = 73/86 (84%), Positives = 75/86 (87%), Gaps = 3/86 (3%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSS-SPWYGPDRVKYLGPFSGESPSYLT 242 FAGK L PSSSE+ G GRI+MRKT AKPK SS SPWYGPDRVKYLGPFSGESPSYLT Sbjct: 13 FAGKTVKLAPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLT 72 Query: 243 GEFAGDYGWDTAGLSADPETFAKNRE 320 GEF GDYGWDTAGLSADPETFAKNRE Sbjct: 73 GEFPGDYGWDTAGLSADPETFAKNRE 98 >ref|XP_004234062.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 5 [Solanum lycopersicum] Length = 255 Score = 147 bits (372), Expect = 1e-33 Identities = 73/86 (84%), Positives = 75/86 (87%), Gaps = 3/86 (3%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSS-SPWYGPDRVKYLGPFSGESPSYLT 242 FAGK L PSSSE+ G GRI+MRKT AKPK SS SPWYGPDRVKYLGPFSGESPSYLT Sbjct: 13 FAGKTVKLAPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLT 72 Query: 243 GEFAGDYGWDTAGLSADPETFAKNRE 320 GEF GDYGWDTAGLSADPETFAKNRE Sbjct: 73 GEFPGDYGWDTAGLSADPETFAKNRE 98 >ref|XP_004234058.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 1 [Solanum lycopersicum] gi|460376546|ref|XP_004234059.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 2 [Solanum lycopersicum] gi|460376548|ref|XP_004234060.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 3 [Solanum lycopersicum] gi|460376550|ref|XP_004234061.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 4 [Solanum lycopersicum] Length = 267 Score = 147 bits (372), Expect = 1e-33 Identities = 73/86 (84%), Positives = 75/86 (87%), Gaps = 3/86 (3%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSS-SPWYGPDRVKYLGPFSGESPSYLT 242 FAGK L PSSSE+ G GRI+MRKT AKPK SS SPWYGPDRVKYLGPFSGESPSYLT Sbjct: 13 FAGKTVKLAPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLT 72 Query: 243 GEFAGDYGWDTAGLSADPETFAKNRE 320 GEF GDYGWDTAGLSADPETFAKNRE Sbjct: 73 GEFPGDYGWDTAGLSADPETFAKNRE 98 >gb|AFO67221.1| putative chlorophyll a/b binding protein, partial [Aralia elata] Length = 152 Score = 147 bits (372), Expect = 1e-33 Identities = 71/85 (83%), Positives = 74/85 (87%), Gaps = 2/85 (2%) Frame = +3 Query: 72 FAGKAL--VPSSSEVFGEGRISMRKTTAKPKTVSSSPWYGPDRVKYLGPFSGESPSYLTG 245 FAGKA+ PSSSE+FG GRISMRKT KP S SPWYGPDRVKYLGPFSGE+PSYLTG Sbjct: 13 FAGKAVKVAPSSSELFGNGRISMRKTGKKPVASSGSPWYGPDRVKYLGPFSGEAPSYLTG 72 Query: 246 EFAGDYGWDTAGLSADPETFAKNRE 320 EF GDYGWDTAGLSADPETFAKNRE Sbjct: 73 EFPGDYGWDTAGLSADPETFAKNRE 97 >sp|P27495.1|CB24_TOBAC RecName: Full=Chlorophyll a-b binding protein 40, chloroplastic; AltName: Full=LHCII type I CAB-40; Short=LHCP; Flags: Precursor gi|19829|emb|CAA36958.1| unnamed protein product [Nicotiana tabacum] Length = 267 Score = 146 bits (369), Expect = 3e-33 Identities = 72/86 (83%), Positives = 77/86 (89%), Gaps = 3/86 (3%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSS-SPWYGPDRVKYLGPFSGESPSYLT 242 FAGKA L PSSSE+ G G+++MRKT +K KTVSS SPWYGPDRVKYLGPFSGESPSYLT Sbjct: 13 FAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLT 72 Query: 243 GEFAGDYGWDTAGLSADPETFAKNRE 320 GEF GDYGWDTAGLSADPETFAKNRE Sbjct: 73 GEFPGDYGWDTAGLSADPETFAKNRE 98 >gb|AAB87573.1| chlorophyll a/b binding protein of LHCII type I precursor [Panax ginseng] Length = 266 Score = 145 bits (367), Expect = 4e-33 Identities = 70/85 (82%), Positives = 73/85 (85%), Gaps = 2/85 (2%) Frame = +3 Query: 72 FAGKAL--VPSSSEVFGEGRISMRKTTAKPKTVSSSPWYGPDRVKYLGPFSGESPSYLTG 245 FAG A+ PSSSE+FG GRISMRKT KP S SPWYGPDRVKYLGPFSGE+PSYLTG Sbjct: 13 FAGMAVKVAPSSSELFGSGRISMRKTGKKPAASSGSPWYGPDRVKYLGPFSGEAPSYLTG 72 Query: 246 EFAGDYGWDTAGLSADPETFAKNRE 320 EF GDYGWDTAGLSADPETFAKNRE Sbjct: 73 EFPGDYGWDTAGLSADPETFAKNRE 97 >ref|NP_565786.1| photosystem II light harvesting complex protein B1B2 [Arabidopsis thaliana] gi|13926260|gb|AAK49602.1|AF372886_1 At2g34420/T31E10.24 [Arabidopsis thaliana] gi|16226426|gb|AAL16165.1|AF428397_1 At2g34420/T31E10.24 [Arabidopsis thaliana] gi|16930391|gb|AAL31882.1|AF419548_1 At2g34420/T31E10.24 [Arabidopsis thaliana] gi|16930467|gb|AAL31919.1|AF419587_1 At2g34420/T31E10.24 [Arabidopsis thaliana] gi|16364|emb|CAA45790.1| photosystem II type I chlorophyll a /b binding protein [Arabidopsis thaliana] gi|3128230|gb|AAC26710.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|14517452|gb|AAK62616.1| At2g34420/T31E10.24 [Arabidopsis thaliana] gi|15027899|gb|AAK76480.1| putative photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|17473689|gb|AAL38301.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|19310503|gb|AAL84985.1| At2g34420/T31E10.24 [Arabidopsis thaliana] gi|19310521|gb|AAL84994.1| At2g34420/T31E10.24 [Arabidopsis thaliana] gi|20148517|gb|AAM10149.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|20197168|gb|AAM14954.1| photosystem II type I chlorophyll a b binding protein [Arabidopsis thaliana] gi|23296426|gb|AAN13114.1| putative photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|110739111|dbj|BAF01472.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|330253878|gb|AEC08972.1| photosystem II light harvesting complex protein B1B2 [Arabidopsis thaliana] Length = 265 Score = 145 bits (366), Expect = 6e-33 Identities = 66/83 (79%), Positives = 73/83 (87%) Frame = +3 Query: 72 FAGKALVPSSSEVFGEGRISMRKTTAKPKTVSSSPWYGPDRVKYLGPFSGESPSYLTGEF 251 FAGKA+ P++S+V G GR++MRKT AKPK S SPWYG DRVKYLGPFSGE PSYLTGEF Sbjct: 13 FAGKAVKPAASDVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEF 72 Query: 252 AGDYGWDTAGLSADPETFAKNRE 320 GDYGWDTAGLSADPETFA+NRE Sbjct: 73 PGDYGWDTAGLSADPETFARNRE 95 >ref|XP_006295385.1| hypothetical protein CARUB_v10024479mg [Capsella rubella] gi|482564093|gb|EOA28283.1| hypothetical protein CARUB_v10024479mg [Capsella rubella] Length = 265 Score = 145 bits (365), Expect = 7e-33 Identities = 66/83 (79%), Positives = 73/83 (87%) Frame = +3 Query: 72 FAGKALVPSSSEVFGEGRISMRKTTAKPKTVSSSPWYGPDRVKYLGPFSGESPSYLTGEF 251 FAGKA+ P++S+V G GR++MRKT AKPK S SPWYG DRVKYLGPFSGE PSYLTGEF Sbjct: 13 FAGKAVKPAASDVLGTGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEF 72 Query: 252 AGDYGWDTAGLSADPETFAKNRE 320 GDYGWDTAGLSADPETFA+NRE Sbjct: 73 PGDYGWDTAGLSADPETFARNRE 95 >dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 265 Score = 145 bits (365), Expect = 7e-33 Identities = 71/85 (83%), Positives = 75/85 (88%), Gaps = 2/85 (2%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSSSPWYGPDRVKYLGPFSGESPSYLTG 245 FAG+A L PS+SE+ G GR+SMRKT AKP SSSPWYGPDRVKYLGPFSGESPSYLTG Sbjct: 13 FAGQAVKLSPSASEITGNGRVSMRKTVAKP-VASSSPWYGPDRVKYLGPFSGESPSYLTG 71 Query: 246 EFAGDYGWDTAGLSADPETFAKNRE 320 EF GDYGWDTAGLSADPETFAKNRE Sbjct: 72 EFPGDYGWDTAGLSADPETFAKNRE 96 >ref|NP_564339.1| chlorophyll A/B binding protein 3 [Arabidopsis thaliana] gi|18397288|ref|NP_564340.1| chlorophyll A/B-binding protein 2 [Arabidopsis thaliana] gi|317374860|sp|P0CJ48.1|CB1A_ARATH RecName: Full=Chlorophyll a-b binding protein 2, chloroplastic; AltName: Full=Chlorophyll a-b protein 165; Short=CAB-165; AltName: Full=LHCII type I CAB-2; Flags: Precursor gi|317374942|sp|Q8VZ87.2|CB1B_ARATH RecName: Full=Chlorophyll a-b binding protein 3, chloroplastic; AltName: Full=Chlorophyll a-b protein 180; Short=CAB-180; AltName: Full=LHCII type I CAB-3; Flags: Precursor gi|9972354|gb|AAG10604.1|AC008030_4 chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|9972355|gb|AAG10605.1|AC008030_5 chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|16368|emb|CAA27540.1| chlorophyll a/b binding protein (LHCP AB 65) [Arabidopsis thaliana] gi|16372|emb|CAA27541.1| chlorophyll a/b binding protein (LHCP AB 180) [Arabidopsis thaliana] gi|15529226|gb|AAK97707.1| At1g29920/F1N18_80 [Arabidopsis thaliana] gi|15809862|gb|AAL06859.1| At1g29920/F1N18_80 [Arabidopsis thaliana] gi|16974375|gb|AAL31113.1| At1g29920/F1N18_80 [Arabidopsis thaliana] gi|17065476|gb|AAL32892.1| chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|20148487|gb|AAM10134.1| chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|21555860|gb|AAM63949.1| photosystem II type I chlorophyll a /b binding protein, putative [Arabidopsis thaliana] gi|22135932|gb|AAM91548.1| photosystem II type I chlorophyll a/b binding protein, putative [Arabidopsis thaliana] gi|23397170|gb|AAN31868.1| putative photosystem II type I chlorophyll a /b binding protein [Arabidopsis thaliana] gi|332193028|gb|AEE31149.1| chlorophyll A/B binding protein 3 [Arabidopsis thaliana] gi|332193029|gb|AEE31150.1| chlorophyll A/B-binding protein 2 [Arabidopsis thaliana] Length = 267 Score = 144 bits (364), Expect = 1e-32 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 2/85 (2%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSSSPWYGPDRVKYLGPFSGESPSYLTG 245 FAGKA L P++SEV G GR++MRKT AKPK S SPWYG DRVKYLGPFSGESPSYLTG Sbjct: 13 FAGKAVNLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTG 72 Query: 246 EFAGDYGWDTAGLSADPETFAKNRE 320 EF GDYGWDTAGLSADPETFA+NRE Sbjct: 73 EFPGDYGWDTAGLSADPETFARNRE 97 >sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor gi|19819|emb|CAA36955.1| unnamed protein product [Nicotiana tabacum] Length = 266 Score = 144 bits (364), Expect = 1e-32 Identities = 72/86 (83%), Positives = 76/86 (88%), Gaps = 3/86 (3%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSS-SPWYGPDRVKYLGPFSGESPSYLT 242 FAGKA L PSSSEV G G+++MRKT +K K VSS SPWYGPDRVKYLGPFSGESPSYLT Sbjct: 12 FAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT 71 Query: 243 GEFAGDYGWDTAGLSADPETFAKNRE 320 GEF GDYGWDTAGLSADPETFAKNRE Sbjct: 72 GEFPGDYGWDTAGLSADPETFAKNRE 97 >ref|NP_174286.1| chlorophyll A/B binding protein 1 [Arabidopsis thaliana] gi|115783|sp|P04778.1|CB1C_ARATH RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; AltName: Full=Chlorophyll a-b protein 140; Short=CAB-140; AltName: Full=LHCII type I CAB-1; Flags: Precursor gi|9972353|gb|AAG10603.1|AC008030_3 Putative chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|16226883|gb|AAL16289.1|AF428359_1 At1g29930/F1N18_23 [Arabidopsis thaliana] gi|16376|emb|CAA27543.1| chlorophyll a/b binding protein (LHCP AB 140) [Arabidopsis thaliana] gi|15010744|gb|AAK74031.1| At1g29930/F1N18_23 [Arabidopsis thaliana] gi|15293003|gb|AAK93612.1| putative photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|16648807|gb|AAL25594.1| At1g29930/F1N18_23 [Arabidopsis thaliana] gi|20258873|gb|AAM14108.1| putative chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|332193030|gb|AEE31151.1| chlorophyll a-b binding protein 1 [Arabidopsis thaliana] Length = 267 Score = 144 bits (364), Expect = 1e-32 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 2/85 (2%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSSSPWYGPDRVKYLGPFSGESPSYLTG 245 FAGKA L P++SEV G GR++MRKT AKPK S SPWYG DRVKYLGPFSGESPSYLTG Sbjct: 13 FAGKAVKLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTG 72 Query: 246 EFAGDYGWDTAGLSADPETFAKNRE 320 EF GDYGWDTAGLSADPETFA+NRE Sbjct: 73 EFPGDYGWDTAGLSADPETFARNRE 97 >ref|XP_002890838.1| hypothetical protein ARALYDRAFT_473204 [Arabidopsis lyrata subsp. lyrata] gi|297336680|gb|EFH67097.1| hypothetical protein ARALYDRAFT_473204 [Arabidopsis lyrata subsp. lyrata] Length = 262 Score = 144 bits (364), Expect = 1e-32 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 2/85 (2%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSSSPWYGPDRVKYLGPFSGESPSYLTG 245 FAGKA L P++SEV G GR++MRKTTAKPK S SPWYG DRVKYLGPFSGE PSYLTG Sbjct: 8 FAGKAVKLSPAASEVLGSGRVTMRKTTAKPKGPSGSPWYGSDRVKYLGPFSGEPPSYLTG 67 Query: 246 EFAGDYGWDTAGLSADPETFAKNRE 320 EF GDYGWDTAGLSADPETFA+NRE Sbjct: 68 EFPGDYGWDTAGLSADPETFARNRE 92 >gb|AAL38341.1| chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|21387019|gb|AAM47913.1| chlorophyll a/b-binding protein [Arabidopsis thaliana] Length = 267 Score = 144 bits (364), Expect = 1e-32 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 2/85 (2%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSSSPWYGPDRVKYLGPFSGESPSYLTG 245 FAGKA L P++SEV G GR++MRKT AKPK S SPWYG DRVKYLGPFSGESPSYLTG Sbjct: 13 FAGKAVNLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTG 72 Query: 246 EFAGDYGWDTAGLSADPETFAKNRE 320 EF GDYGWDTAGLSADPETFA+NRE Sbjct: 73 EFPGDYGWDTAGLSADPETFARNRE 97 >dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 267 Score = 144 bits (363), Expect = 1e-32 Identities = 71/86 (82%), Positives = 76/86 (88%), Gaps = 3/86 (3%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSS-SPWYGPDRVKYLGPFSGESPSYLT 242 FAGKA L PSSSE+ G G+++MRKT +K K VSS SPWYGPDRVKYLGPFSGESPSYLT Sbjct: 13 FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLT 72 Query: 243 GEFAGDYGWDTAGLSADPETFAKNRE 320 GEF GDYGWDTAGLSADPETFAKNRE Sbjct: 73 GEFPGDYGWDTAGLSADPETFAKNRE 98 >gb|AAT08668.1| chloroplast chlorophyll A-B binding protein 40 [Hyacinthus orientalis] Length = 237 Score = 144 bits (363), Expect = 1e-32 Identities = 69/79 (87%), Positives = 72/79 (91%), Gaps = 1/79 (1%) Frame = +3 Query: 87 LVPSSSEVFGEGRISMRKTTAKPKTVSS-SPWYGPDRVKYLGPFSGESPSYLTGEFAGDY 263 L PSSS V G+GR +MRKT AKPKTVSS SPWYGPDRVKYLGPFSGE+PSYLTGEF GDY Sbjct: 5 LTPSSSGVSGDGRFTMRKTVAKPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDY 64 Query: 264 GWDTAGLSADPETFAKNRE 320 GWDTAGLSADPETFAKNRE Sbjct: 65 GWDTAGLSADPETFAKNRE 83 >dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 265 Score = 144 bits (362), Expect = 2e-32 Identities = 70/85 (82%), Positives = 75/85 (88%), Gaps = 2/85 (2%) Frame = +3 Query: 72 FAGKA--LVPSSSEVFGEGRISMRKTTAKPKTVSSSPWYGPDRVKYLGPFSGESPSYLTG 245 FAG+A L PS+SE+ G GR+SMRKT AKP SSSPWYGPDRVKYLGPFSGE+PSYLTG Sbjct: 13 FAGQAVKLSPSASEITGNGRVSMRKTVAKP-VASSSPWYGPDRVKYLGPFSGEAPSYLTG 71 Query: 246 EFAGDYGWDTAGLSADPETFAKNRE 320 EF GDYGWDTAGLSADPETFAKNRE Sbjct: 72 EFPGDYGWDTAGLSADPETFAKNRE 96