BLASTX nr result
ID: Paeonia24_contig00040020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00040020 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB60452.1| hypothetical protein L484_014905 [Morus notabilis] 89 6e-16 ref|XP_004496952.1| PREDICTED: coiled-coil domain-containing pro... 89 6e-16 ref|XP_004488650.1| PREDICTED: coiled-coil domain-containing pro... 89 6e-16 ref|XP_004294098.1| PREDICTED: coiled-coil domain-containing pro... 89 6e-16 gb|ACJ84397.1| unknown [Medicago truncatula] gi|388498032|gb|AFK... 89 6e-16 gb|ACJ83312.1| unknown [Medicago truncatula] 89 6e-16 ref|XP_006477925.1| PREDICTED: coiled-coil domain-containing pro... 89 8e-16 ref|XP_006442249.1| hypothetical protein CICLE_v10021131mg [Citr... 89 8e-16 ref|XP_002298914.2| hypothetical protein POPTR_0001s38700g [Popu... 89 8e-16 ref|XP_006370046.1| hypothetical protein POPTR_0001s38700g [Popu... 89 8e-16 ref|XP_007211525.1| hypothetical protein PRUPE_ppa008122mg [Prun... 89 8e-16 ref|XP_003635597.1| PREDICTED: coiled-coil domain-containing pro... 89 8e-16 emb|CBI14833.3| unnamed protein product [Vitis vinifera] 89 8e-16 ref|XP_002518796.1| Coiled-coil domain-containing protein, putat... 89 8e-16 ref|XP_002317366.2| hypothetical protein POPTR_0011s09840g [Popu... 89 8e-16 ref|XP_004149128.1| PREDICTED: coiled-coil domain-containing pro... 88 1e-15 ref|XP_006594687.1| PREDICTED: coiled-coil domain-containing pro... 87 2e-15 ref|XP_007149323.1| hypothetical protein PHAVU_005G060900g [Phas... 87 2e-15 gb|ACU23145.1| unknown [Glycine max] 87 2e-15 ref|NP_001276289.1| coiled-coil domain-containing protein 94 hom... 87 2e-15 >gb|EXB60452.1| hypothetical protein L484_014905 [Morus notabilis] Length = 351 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+V+RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRCN 44 >ref|XP_004496952.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Cicer arietinum] Length = 326 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDPAKLP+V+RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPAKLPRVRRPKNLQIKVRMMLPMSIRCN 44 >ref|XP_004488650.1| PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X1 [Cicer arietinum] gi|502087813|ref|XP_004488651.1| PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X2 [Cicer arietinum] Length = 330 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+V+RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRCN 44 >ref|XP_004294098.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Fragaria vesca subsp. vesca] Length = 353 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+V+RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRCN 44 >gb|ACJ84397.1| unknown [Medicago truncatula] gi|388498032|gb|AFK37082.1| unknown [Medicago truncatula] Length = 327 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDPAKLP+V+RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPAKLPRVRRPKNLQIKVRMMLPMSIRCN 44 >gb|ACJ83312.1| unknown [Medicago truncatula] Length = 122 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDPAKLP+V+RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPAKLPRVRRPKNLQIKVRMMLPMSIRCN 44 >ref|XP_006477925.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Citrus sinensis] Length = 327 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+++RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCN 44 >ref|XP_006442249.1| hypothetical protein CICLE_v10021131mg [Citrus clementina] gi|557544511|gb|ESR55489.1| hypothetical protein CICLE_v10021131mg [Citrus clementina] Length = 327 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+++RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCN 44 >ref|XP_002298914.2| hypothetical protein POPTR_0001s38700g [Populus trichocarpa] gi|550349201|gb|EEE83719.2| hypothetical protein POPTR_0001s38700g [Populus trichocarpa] Length = 327 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+++RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCN 44 >ref|XP_006370046.1| hypothetical protein POPTR_0001s38700g [Populus trichocarpa] gi|550349200|gb|ERP66615.1| hypothetical protein POPTR_0001s38700g [Populus trichocarpa] Length = 230 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+++RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCN 44 >ref|XP_007211525.1| hypothetical protein PRUPE_ppa008122mg [Prunus persica] gi|462407390|gb|EMJ12724.1| hypothetical protein PRUPE_ppa008122mg [Prunus persica] Length = 344 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+++RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCN 44 >ref|XP_003635597.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Vitis vinifera] Length = 184 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+++RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCN 44 >emb|CBI14833.3| unnamed protein product [Vitis vinifera] Length = 183 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+++RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCN 44 >ref|XP_002518796.1| Coiled-coil domain-containing protein, putative [Ricinus communis] gi|223542177|gb|EEF43721.1| Coiled-coil domain-containing protein, putative [Ricinus communis] Length = 360 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+++RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCN 44 >ref|XP_002317366.2| hypothetical protein POPTR_0011s09840g [Populus trichocarpa] gi|118487268|gb|ABK95462.1| unknown [Populus trichocarpa] gi|550328031|gb|EEE97978.2| hypothetical protein POPTR_0011s09840g [Populus trichocarpa] Length = 327 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+++RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCN 44 >ref|XP_004149128.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Cucumis sativus] gi|449494611|ref|XP_004159597.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Cucumis sativus] Length = 327 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+V+RPKN Q+KVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQMKVRMMLPMSIRCN 44 >ref|XP_006594687.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Glycine max] Length = 326 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+ +RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRARRPKNQQIKVRMMLPMSIRCN 44 >ref|XP_007149323.1| hypothetical protein PHAVU_005G060900g [Phaseolus vulgaris] gi|561022587|gb|ESW21317.1| hypothetical protein PHAVU_005G060900g [Phaseolus vulgaris] Length = 323 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+ +RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRARRPKNQQIKVRMMLPMSIRCN 44 >gb|ACU23145.1| unknown [Glycine max] Length = 252 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+ +RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRARRPKNQQIKVRMMLPMSIRCN 44 >ref|NP_001276289.1| coiled-coil domain-containing protein 94 homolog [Glycine max] gi|255642439|gb|ACU21483.1| unknown [Glycine max] Length = 326 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 240 MGERKVLNKYYPPEFDPAKLPKVKRPKNHQIKVRMMLPMSIRCN 371 MGERKVLNKYYPP+FDP+KLP+ +RPKN QIKVRMMLPMSIRCN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRARRPKNQQIKVRMMLPMSIRCN 44