BLASTX nr result
ID: Paeonia24_contig00039354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00039354 (226 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW74479.1| arabinose efflux permease [Paeonia suffruticosa] 62 1e-07 >gb|ABW74479.1| arabinose efflux permease [Paeonia suffruticosa] Length = 52 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 224 DKFNEDGENEDSIAKKANTRPLLDGNRNQLLDTSG 120 DKFNEDGEN+ SI KKAN +PLLDGNR+QL DTSG Sbjct: 18 DKFNEDGENDGSIVKKANMKPLLDGNRDQLRDTSG 52