BLASTX nr result
ID: Paeonia24_contig00038951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00038951 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlise... 61 2e-08 >gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlisea aurea] Length = 88 Score = 60.8 bits (146), Expect(2) = 2e-08 Identities = 29/51 (56%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = +3 Query: 75 HPNWTEPFVRLLFPPSHGVRHRFLNKSNL-LNCMMDFPEKHWRTCKRGALP 224 H N T+PFV LLF S+GVRHR ++ ++ MM+ PEK WR CKRGALP Sbjct: 35 HSNRTKPFVMLLFSQSYGVRHRLQDQISIDFEWMMESPEKPWRACKRGALP 85 Score = 23.1 bits (48), Expect(2) = 2e-08 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 16 VFTLSISQIKDGFY 57 VFT ISQI DG Y Sbjct: 17 VFTFQISQIVDGVY 30