BLASTX nr result
ID: Paeonia24_contig00038817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00038817 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66330.1| hypothetical protein VITISV_000598 [Vitis vinifera] 48 1e-10 ref|XP_007214504.1| hypothetical protein PRUPE_ppa016706mg, part... 45 9e-10 ref|XP_007207617.1| hypothetical protein PRUPE_ppa019748mg, part... 45 3e-09 emb|CAN75947.1| hypothetical protein VITISV_014170 [Vitis vinifera] 44 4e-09 gb|EXB94881.1| hypothetical protein L484_022988 [Morus notabilis] 44 4e-09 emb|CAN59965.1| hypothetical protein VITISV_022758 [Vitis vinifera] 47 7e-09 ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, part... 45 2e-08 ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prun... 45 2e-08 emb|CAN74312.1| hypothetical protein VITISV_037520 [Vitis vinifera] 44 2e-08 emb|CAN75609.1| hypothetical protein VITISV_002943 [Vitis vinifera] 44 2e-08 emb|CAN74340.1| hypothetical protein VITISV_017446 [Vitis vinifera] 46 3e-08 emb|CAN82413.1| hypothetical protein VITISV_039150 [Vitis vinifera] 44 4e-08 emb|CAN68838.1| hypothetical protein VITISV_030956 [Vitis vinifera] 44 7e-08 ref|XP_007202950.1| hypothetical protein PRUPE_ppa016504mg, part... 43 7e-08 ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, part... 46 7e-08 emb|CAN65484.1| hypothetical protein VITISV_029474 [Vitis vinifera] 44 1e-07 emb|CAN83313.1| hypothetical protein VITISV_001463 [Vitis vinifera] 45 1e-07 emb|CAN61757.1| hypothetical protein VITISV_030741 [Vitis vinifera] 44 1e-07 emb|CAN67932.1| hypothetical protein VITISV_013913 [Vitis vinifera] 42 2e-07 gb|EXC19385.1| Dihydrolipoyllysine-residue acetyltransferase com... 41 2e-07 >emb|CAN66330.1| hypothetical protein VITISV_000598 [Vitis vinifera] Length = 2691 Score = 48.1 bits (113), Expect(2) = 1e-10 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -2 Query: 246 KWAPFPCRFENMWYSHHLFKKQIHNWWQD 160 KW P P RFENMW HH FK+ +WW++ Sbjct: 1756 KWGPTPFRFENMWLQHHNFKESFSSWWRE 1784 Score = 43.5 bits (101), Expect(2) = 1e-10 Identities = 19/48 (39%), Positives = 29/48 (60%) Frame = -3 Query: 152 SGWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLE 9 +GW+G+KF KL+ +K K+K WNK +LK + S E+ D +E Sbjct: 1788 NGWEGHKFMRKLQFVKAKLKDWNKNTFGLLKERKKSISDEIANIDAIE 1835 >ref|XP_007214504.1| hypothetical protein PRUPE_ppa016706mg, partial [Prunus persica] gi|462410369|gb|EMJ15703.1| hypothetical protein PRUPE_ppa016706mg, partial [Prunus persica] Length = 992 Score = 44.7 bits (104), Expect(2) = 9e-10 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = -2 Query: 249 VKWAPFPCRFENMWYSHHLFKKQIHNWW 166 +KW P P RFENMW H FKK+ WW Sbjct: 168 LKWGPGPFRFENMWIEHPEFKKKFKQWW 195 Score = 43.9 bits (102), Expect(2) = 9e-10 Identities = 22/55 (40%), Positives = 31/55 (56%) Frame = -3 Query: 167 GKISDSGWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLEAR 3 G+ +GW+GYKF +L IK KIK WNKEV L + + A + D +E + Sbjct: 196 GEDQINGWEGYKFPRRLRTIKQKIKDWNKEVFGDLVSAKKEAEARIAALDLMEGQ 250 >ref|XP_007207617.1| hypothetical protein PRUPE_ppa019748mg, partial [Prunus persica] gi|462403259|gb|EMJ08816.1| hypothetical protein PRUPE_ppa019748mg, partial [Prunus persica] Length = 1170 Score = 44.7 bits (104), Expect(2) = 3e-09 Identities = 22/55 (40%), Positives = 32/55 (58%) Frame = -3 Query: 167 GKISDSGWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLEAR 3 G+ +GW+GYKF+ +L IK KIK WNKEV L + + A + D +E + Sbjct: 250 GEDQINGWEGYKFSRRLRTIKQKIKDWNKEVFGDLVSAKKEAEARIAALDLMEGQ 304 Score = 42.0 bits (97), Expect(2) = 3e-09 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -2 Query: 249 VKWAPFPCRFENMWYSHHLFKKQIHNWW 166 +KW P P RFENMW + FKK+ WW Sbjct: 222 LKWGPGPFRFENMWIDYPYFKKKFKLWW 249 >emb|CAN75947.1| hypothetical protein VITISV_014170 [Vitis vinifera] Length = 1767 Score = 43.5 bits (101), Expect(2) = 4e-09 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -2 Query: 246 KWAPFPCRFENMWYSHHLFKKQIHNWWQD 160 KW P P RFENMW H FK+ +WW++ Sbjct: 803 KWGPTPFRFENMWLQHPSFKECFSSWWRE 831 Score = 42.7 bits (99), Expect(2) = 4e-09 Identities = 19/48 (39%), Positives = 29/48 (60%) Frame = -3 Query: 152 SGWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLE 9 +GW+G+KF KL+ +K K+K WNK E+LK + E+ D +E Sbjct: 835 NGWEGHKFMKKLQFVKAKLKDWNKNTFELLKERKKTVLDEIANIDVIE 882 >gb|EXB94881.1| hypothetical protein L484_022988 [Morus notabilis] Length = 355 Score = 43.5 bits (101), Expect(2) = 4e-09 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = -3 Query: 149 GWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLE 9 GW GYKF KL+ ++ ++K+WNKEV + + S + E DR+E Sbjct: 287 GWAGYKFMRKLKNMRGQLKIWNKEVFGDTRVEKLIKSKIIAEIDRVE 333 Score = 42.7 bits (99), Expect(2) = 4e-09 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 243 WAPFPCRFENMWYSHHLFKKQIHNWWQD 160 W P P RFEN+W H FKK + WW++ Sbjct: 255 WGPTPFRFENIWLEHKRFKKDLEVWWRE 282 >emb|CAN59965.1| hypothetical protein VITISV_022758 [Vitis vinifera] Length = 908 Score = 47.4 bits (111), Expect(2) = 7e-09 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -2 Query: 246 KWAPFPCRFENMWYSHHLFKKQIHNWWQDLR 154 KW P P RFENMW HH F + +WW++ + Sbjct: 76 KWGPTPFRFENMWLQHHSFNESFSSWWREFK 106 Score = 38.1 bits (87), Expect(2) = 7e-09 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -3 Query: 152 SGWKGYKFTWKLEQIKNKIKMWNKEVLEILK 60 +GW+G+KF KL+ +K K+K WNK +LK Sbjct: 108 NGWEGHKFMRKLQFVKAKLKDWNKNTFGMLK 138 >ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] gi|462408445|gb|EMJ13779.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] Length = 1499 Score = 45.4 bits (106), Expect(2) = 2e-08 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 249 VKWAPFPCRFENMWYSHHLFKKQIHNWW 166 VKW P P RFENMW +H FK++I WW Sbjct: 556 VKWGPSPFRFENMWLNHPDFKRKIKLWW 583 Score = 38.9 bits (89), Expect(2) = 2e-08 Identities = 13/24 (54%), Positives = 21/24 (87%) Frame = -3 Query: 149 GWKGYKFTWKLEQIKNKIKMWNKE 78 GW+GYKF +L+ +K+K+K+W+KE Sbjct: 590 GWEGYKFMTRLKMLKSKLKVWSKE 613 >ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] gi|462409892|gb|EMJ15226.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] Length = 1421 Score = 45.4 bits (106), Expect(2) = 2e-08 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 249 VKWAPFPCRFENMWYSHHLFKKQIHNWW 166 VKW P P RFENMW +H FK++I WW Sbjct: 502 VKWGPSPFRFENMWLNHPDFKRKIKLWW 529 Score = 38.9 bits (89), Expect(2) = 2e-08 Identities = 13/24 (54%), Positives = 21/24 (87%) Frame = -3 Query: 149 GWKGYKFTWKLEQIKNKIKMWNKE 78 GW+GYKF +L+ +K+K+K+W+KE Sbjct: 536 GWEGYKFMTRLKMLKSKLKVWSKE 559 >emb|CAN74312.1| hypothetical protein VITISV_037520 [Vitis vinifera] Length = 1915 Score = 44.3 bits (103), Expect(2) = 2e-08 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -2 Query: 243 WAPFPCRFENMWYSHHLFKKQIHNWWQD 160 W P P RFENMW H FK++ +WWQ+ Sbjct: 973 WGPTPFRFENMWLLHXEFKEKFRDWWQE 1000 Score = 39.7 bits (91), Expect(2) = 2e-08 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = -3 Query: 149 GWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLE 9 GW+G+KF KL+ IK+K+K WN V L+ + ++ DR+E Sbjct: 1005 GWEGHKFMRKLKFIKSKLKEWNTRVFGDLRERKKHILTDLGRIDRIE 1051 >emb|CAN75609.1| hypothetical protein VITISV_002943 [Vitis vinifera] Length = 1599 Score = 43.9 bits (102), Expect(2) = 2e-08 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -2 Query: 243 WAPFPCRFENMWYSHHLFKKQIHNWWQD 160 W P P RFENMW H FK++ +WWQ+ Sbjct: 86 WGPTPFRFENMWLLHPEFKEKFRDWWQE 113 Score = 40.0 bits (92), Expect(2) = 2e-08 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -3 Query: 158 SDSGWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLE 9 S GW+G+KF KL+ IK+K+K WN V L+ + ++ DR+E Sbjct: 115 SVEGWEGHKFMRKLKFIKSKLKEWNTRVFGDLRERKKHILTDLGRIDRIE 164 >emb|CAN74340.1| hypothetical protein VITISV_017446 [Vitis vinifera] Length = 1456 Score = 46.2 bits (108), Expect(2) = 3e-08 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = -2 Query: 249 VKWAPFPCRFENMWYSHHLFKKQIHNWWQD 160 +KW P P RFENMW H FK++ +WWQ+ Sbjct: 862 LKWGPTPFRFENMWLLHPEFKEKFRDWWQE 891 Score = 37.0 bits (84), Expect(2) = 3e-08 Identities = 17/47 (36%), Positives = 28/47 (59%) Frame = -3 Query: 149 GWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLE 9 GW+G+KF KL+ IK+K+K WN L+ + +++ DR+E Sbjct: 896 GWEGHKFMRKLKFIKSKLKEWNIVAFGDLRERKKHILSDLGRIDRIE 942 >emb|CAN82413.1| hypothetical protein VITISV_039150 [Vitis vinifera] Length = 1075 Score = 43.5 bits (101), Expect(2) = 4e-08 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -2 Query: 246 KWAPFPCRFENMWYSHHLFKKQIHNWWQD 160 KW P P RFENMW H FK+ +WW++ Sbjct: 49 KWGPTPFRFENMWLQHPSFKECFSSWWRE 77 Score = 39.3 bits (90), Expect(2) = 4e-08 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = -3 Query: 152 SGWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLE 9 +GW+G+KF KL+ +K K+K WNK LK + E+ D +E Sbjct: 81 NGWEGHKFMRKLQFVKAKLKDWNKNSFGTLKERKKSILDEIANIDAIE 128 >emb|CAN68838.1| hypothetical protein VITISV_030956 [Vitis vinifera] Length = 1881 Score = 44.3 bits (103), Expect(2) = 7e-08 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -2 Query: 246 KWAPFPCRFENMWYSHHLFKKQIHNWWQDLR 154 KW P P RFENMW H FK+ WW++ + Sbjct: 1064 KWGPTPFRFENMWLQHPSFKENFGRWWREFQ 1094 Score = 37.7 bits (86), Expect(2) = 7e-08 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 8/48 (16%) Frame = -3 Query: 152 SGWKGYKFTWKLEQIKNKIKMWNKEVL--------EILKALQYFFSAE 33 +GW+G+KF KL+ +K K+K+WNK +IL AL F S E Sbjct: 1096 NGWEGHKFMRKLQFVKAKLKVWNKASFGELSKRKEDILSALVNFDSLE 1143 >ref|XP_007202950.1| hypothetical protein PRUPE_ppa016504mg, partial [Prunus persica] gi|462398481|gb|EMJ04149.1| hypothetical protein PRUPE_ppa016504mg, partial [Prunus persica] Length = 1162 Score = 43.1 bits (100), Expect(2) = 7e-08 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = -2 Query: 249 VKWAPFPCRFENMWYSHHLFKKQIHNWW 166 VKW P P RFENMW +H F ++I WW Sbjct: 220 VKWGPSPFRFENMWLNHPDFMRKIKLWW 247 Score = 38.9 bits (89), Expect(2) = 7e-08 Identities = 13/24 (54%), Positives = 21/24 (87%) Frame = -3 Query: 149 GWKGYKFTWKLEQIKNKIKMWNKE 78 GW+GYKF +L+ +K+K+K+W+KE Sbjct: 254 GWEGYKFMTRLKMLKSKLKVWSKE 277 >ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] gi|462396886|gb|EMJ02685.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] Length = 983 Score = 46.2 bits (108), Expect(2) = 7e-08 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -2 Query: 249 VKWAPFPCRFENMWYSHHLFKKQIHNWW 166 VKW P P RFENMW +H FK++I WW Sbjct: 142 VKWGPLPFRFENMWLNHPDFKRKIKLWW 169 Score = 35.8 bits (81), Expect(2) = 7e-08 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = -3 Query: 167 GKISDSGWKGYKFTWKLEQIKNKIKMWNKE 78 G+ SG +GYKF +L+ +K+K+K+W+KE Sbjct: 170 GEDQISGLEGYKFMTRLKMLKSKLKVWSKE 199 >emb|CAN65484.1| hypothetical protein VITISV_029474 [Vitis vinifera] Length = 1882 Score = 44.3 bits (103), Expect(2) = 1e-07 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -2 Query: 246 KWAPFPCRFENMWYSHHLFKKQIHNWWQDLR 154 KW P P RFENMW H FK+ WW++ + Sbjct: 898 KWGPTPFRFENMWLQHPSFKENFGRWWREFQ 928 Score = 37.0 bits (84), Expect(2) = 1e-07 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = -3 Query: 152 SGWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLE 9 +GW+G+KF KL+ +K K+K+WNK L + +++ D LE Sbjct: 930 NGWEGHKFMRKLQFVKAKLKVWNKASFGELSKRKEDILSDLVNFDSLE 977 >emb|CAN83313.1| hypothetical protein VITISV_001463 [Vitis vinifera] Length = 1780 Score = 44.7 bits (104), Expect(2) = 1e-07 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -2 Query: 246 KWAPFPCRFENMWYSHHLFKKQIHNWWQDLR 154 KW P P RFENMW H FK+ WW++ + Sbjct: 987 KWGPMPFRFENMWLQHPNFKESFGRWWREFQ 1017 Score = 36.6 bits (83), Expect(2) = 1e-07 Identities = 13/24 (54%), Positives = 20/24 (83%) Frame = -3 Query: 152 SGWKGYKFTWKLEQIKNKIKMWNK 81 +GW+G+KF KL+ +K+K+K WNK Sbjct: 1019 NGWEGHKFMRKLQFVKDKLKEWNK 1042 >emb|CAN61757.1| hypothetical protein VITISV_030741 [Vitis vinifera] Length = 1306 Score = 44.3 bits (103), Expect(2) = 1e-07 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -2 Query: 246 KWAPFPCRFENMWYSHHLFKKQIHNWWQDLR 154 KW P P RFENMW H FK+ +WW++ + Sbjct: 648 KWGPTPFRFENMWLQHLSFKESFGSWWREFQ 678 Score = 37.0 bits (84), Expect(2) = 1e-07 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = -3 Query: 152 SGWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLE 9 +GW+G+KF KL+ IK K+K WNK L + +++ D LE Sbjct: 680 NGWEGHKFMRKLQFIKAKLKEWNKASFGELSKRKKSILSDLANFDTLE 727 >emb|CAN67932.1| hypothetical protein VITISV_013913 [Vitis vinifera] Length = 2077 Score = 42.0 bits (97), Expect(2) = 2e-07 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -2 Query: 246 KWAPFPCRFENMWYSHHLFKKQIHNWWQDLR 154 KW P P FENMW H FK+ +WW++ + Sbjct: 628 KWGPTPFGFENMWLQHPSFKESFGSWWREFQ 658 Score = 38.5 bits (88), Expect(2) = 2e-07 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = -3 Query: 152 SGWKGYKFTWKLEQIKNKIKMWNKEVLEILKALQYFFSAEVQESDRLE 9 +GW+G+KF KL+ +K K+K WNK L + + +++ D LE Sbjct: 660 NGWEGHKFIRKLQFVKAKLKEWNKTSFGELSKRKKYILSDLANFDSLE 707 >gb|EXC19385.1| Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex [Morus notabilis] Length = 446 Score = 40.8 bits (94), Expect(2) = 2e-07 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -2 Query: 249 VKWAPFPCRFENMWYSHHLFKKQIHNWWQDL 157 VKW P RFENMW H F+K+ WW ++ Sbjct: 334 VKWEPTLFRFENMWLDHPSFRKECEIWWGNM 364 Score = 39.7 bits (91), Expect(2) = 2e-07 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = -3 Query: 167 GKISDSGWKGYKFTWKLEQIKNKIKMWNKE 78 G ++ GW+GYK KL+ +K+K+K WNKE Sbjct: 362 GNMNPVGWEGYKIMEKLKGLKDKLKTWNKE 391