BLASTX nr result
ID: Paeonia24_contig00038642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00038642 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276470.2| PREDICTED: uncharacterized protein At5g41620... 55 8e-06 >ref|XP_002276470.2| PREDICTED: uncharacterized protein At5g41620-like [Vitis vinifera] Length = 648 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/54 (53%), Positives = 34/54 (62%), Gaps = 6/54 (11%) Frame = -1 Query: 181 PCTPPPTWSLGFGQDGENKDA---LTFPSTISARKLGANLWEI---LPVAKMNK 38 PCTP PTW LGF + L +++SARKLGANLWEI LPVA MN+ Sbjct: 17 PCTPSPTWRLGFSLNDATSSIDKDLDCSTSVSARKLGANLWEIQSHLPVANMNR 70