BLASTX nr result
ID: Paeonia24_contig00038361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00038361 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523591.1| DNA binding protein, putative [Ricinus commu... 55 8e-06 >ref|XP_002523591.1| DNA binding protein, putative [Ricinus communis] gi|223537153|gb|EEF38786.1| DNA binding protein, putative [Ricinus communis] Length = 386 Score = 55.5 bits (132), Expect = 8e-06 Identities = 38/89 (42%), Positives = 48/89 (53%), Gaps = 3/89 (3%) Frame = +2 Query: 188 LQIEETKVTVYEILQXXXXXXXXXXXXXXXXRKTSSLMDKILNKLKVSQMKAQEMRSSIW 367 LQ EE K+T +E LQ +K S MDKILNKL+ +Q+KAQEMRSSI Sbjct: 292 LQREEAKITAWENLQKAKAEAAIRKLEMKLEKKRSLSMDKILNKLRTAQIKAQEMRSSIP 351 Query: 368 ESLD-QTPK--HKFNVETNSSEMRIVVVC 445 + D QTPK HK + + + V C Sbjct: 352 TTQDPQTPKISHKASFFHRHTRLTSVSSC 380