BLASTX nr result
ID: Paeonia24_contig00038353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00038353 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515000.1| ankyrin repeat-containing protein, putative ... 59 5e-07 >ref|XP_002515000.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223546051|gb|EEF47554.1| ankyrin repeat-containing protein, putative [Ricinus communis] Length = 663 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 301 YKQMSLNKRLMNQYFCFGAQGLVVENSVSRARRSLSFK 188 +KQ S NKRLMNQYFCFGAQGLVVENS+S + S+K Sbjct: 619 HKQTSFNKRLMNQYFCFGAQGLVVENSISYRHQDQSYK 656