BLASTX nr result
ID: Paeonia24_contig00038028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00038028 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ85863.1| unknown [Medicago truncatula] gi|388500264|gb|AFK... 58 2e-06 ref|XP_007147472.1| hypothetical protein PHAVU_006G127400g [Phas... 56 5e-06 ref|XP_007147471.1| hypothetical protein PHAVU_006G127300g [Phas... 56 5e-06 ref|XP_004504713.1| PREDICTED: uncharacterized protein LOC101499... 56 5e-06 ref|XP_006368006.1| PREDICTED: uncharacterized protein LOC102587... 56 6e-06 >gb|ACJ85863.1| unknown [Medicago truncatula] gi|388500264|gb|AFK38198.1| unknown [Medicago truncatula] Length = 430 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +3 Query: 249 RNENEIKSSVFLSPVFVMKPGSVVNKFYRDIDFPRG 356 + EN+IKS+VFLSP F + PGSV+NK+Y DIDFPRG Sbjct: 30 KTENKIKSAVFLSPKFELGPGSVINKYYYDIDFPRG 65 >ref|XP_007147472.1| hypothetical protein PHAVU_006G127400g [Phaseolus vulgaris] gi|561020695|gb|ESW19466.1| hypothetical protein PHAVU_006G127400g [Phaseolus vulgaris] Length = 404 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 255 ENEIKSSVFLSPVFVMKPGSVVNKFYRDIDFPRG 356 EN IK+SVFLSP F + PGSV NKFY D+DFPRG Sbjct: 32 ENNIKTSVFLSPKFELGPGSVANKFYYDVDFPRG 65 >ref|XP_007147471.1| hypothetical protein PHAVU_006G127300g [Phaseolus vulgaris] gi|561020694|gb|ESW19465.1| hypothetical protein PHAVU_006G127300g [Phaseolus vulgaris] Length = 404 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 255 ENEIKSSVFLSPVFVMKPGSVVNKFYRDIDFPRG 356 EN IK+SVFLSP F + PGSV NKFY D+DFPRG Sbjct: 32 ENNIKTSVFLSPKFELGPGSVANKFYYDVDFPRG 65 >ref|XP_004504713.1| PREDICTED: uncharacterized protein LOC101499286 [Cicer arietinum] Length = 431 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +3 Query: 249 RNENEIKSSVFLSPVFVMKPGSVVNKFYRDIDFPRG 356 ++E++IKSSVFLSP F + PGSV+N++Y DIDFPRG Sbjct: 29 KSEDKIKSSVFLSPKFELGPGSVINRYYYDIDFPRG 64 >ref|XP_006368006.1| PREDICTED: uncharacterized protein LOC102587597 [Solanum tuberosum] Length = 458 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +3 Query: 249 RNENEIKSSVFLSPVFVMKPGSVVNKFYRDIDFPRG 356 RNEN++K++ FLSP FV++PG V NKFY +IDFP+G Sbjct: 29 RNENKVKTATFLSPNFVLEPGLVANKFYYNIDFPKG 64