BLASTX nr result
ID: Paeonia24_contig00037921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00037921 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB54575.1| hypothetical protein L484_019144 [Morus notabilis] 110 2e-22 ref|XP_007027780.1| Pentatricopeptide repeat (PPR) superfamily p... 108 8e-22 ref|XP_006481751.1| PREDICTED: putative pentatricopeptide repeat... 108 1e-21 ref|XP_006430175.1| hypothetical protein CICLE_v10011274mg [Citr... 108 1e-21 ref|XP_002276416.2| PREDICTED: putative pentatricopeptide repeat... 108 1e-21 emb|CBI30310.3| unnamed protein product [Vitis vinifera] 108 1e-21 ref|XP_004305658.1| PREDICTED: putative pentatricopeptide repeat... 107 1e-21 ref|XP_003537073.1| PREDICTED: putative pentatricopeptide repeat... 107 2e-21 ref|XP_002882733.1| pentatricopeptide repeat-containing protein ... 107 2e-21 ref|XP_006407445.1| hypothetical protein EUTSA_v10022435mg [Eutr... 107 2e-21 ref|XP_006299290.1| hypothetical protein CARUB_v10015444mg [Caps... 105 7e-21 ref|XP_004494044.1| PREDICTED: putative pentatricopeptide repeat... 105 9e-21 ref|NP_187753.1| mitochondrial RNA editing factor 10 [Arabidopsi... 103 2e-20 ref|XP_006341234.1| PREDICTED: putative pentatricopeptide repeat... 103 3e-20 ref|XP_007144843.1| hypothetical protein PHAVU_007G188900g [Phas... 103 3e-20 ref|XP_004246502.1| PREDICTED: putative pentatricopeptide repeat... 102 6e-20 ref|XP_004156253.1| PREDICTED: putative pentatricopeptide repeat... 101 1e-19 ref|XP_004143385.1| PREDICTED: putative pentatricopeptide repeat... 101 1e-19 ref|NP_001044643.1| Os01g0819800 [Oryza sativa Japonica Group] g... 97 2e-18 gb|EAZ35608.1| hypothetical protein OsJ_19898 [Oryza sativa Japo... 97 2e-18 >gb|EXB54575.1| hypothetical protein L484_019144 [Morus notabilis] Length = 636 Score = 110 bits (275), Expect = 2e-22 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 +NT GTEIVVIKNLR C DCHLF+KLVSK+VDR+FV+RDATRFHHFKDG CSC+DYW Sbjct: 579 VNTSPGTEIVVIKNLRACGDCHLFIKLVSKIVDRKFVVRDATRFHHFKDGVCSCRDYW 636 >ref|XP_007027780.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508716385|gb|EOY08282.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 610 Score = 108 bits (270), Expect = 8e-22 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LN+E GTEIVVIKNLRVC DCHLF+K VSK+VDR+ V+RDATRFHHF+DG CSCKDYW Sbjct: 553 LNSEPGTEIVVIKNLRVCEDCHLFLKGVSKIVDRQLVVRDATRFHHFRDGLCSCKDYW 610 >ref|XP_006481751.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Citrus sinensis] Length = 636 Score = 108 bits (269), Expect = 1e-21 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 +NT GTEIVV+KNLR+C DCHLF+KLVSK+VDR+F++RDATRFHHFK G CSCKDYW Sbjct: 579 INTSPGTEIVVMKNLRICGDCHLFIKLVSKIVDRQFIVRDATRFHHFKSGFCSCKDYW 636 >ref|XP_006430175.1| hypothetical protein CICLE_v10011274mg [Citrus clementina] gi|557532232|gb|ESR43415.1| hypothetical protein CICLE_v10011274mg [Citrus clementina] Length = 636 Score = 108 bits (269), Expect = 1e-21 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 +NT GTEIVV+KNLR+C DCHLF+KLVSK+VDR+F++RDATRFHHFK G CSCKDYW Sbjct: 579 INTSPGTEIVVMKNLRICGDCHLFIKLVSKIVDRQFIVRDATRFHHFKSGFCSCKDYW 636 >ref|XP_002276416.2| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Vitis vinifera] Length = 629 Score = 108 bits (269), Expect = 1e-21 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 +NTE GTEI VIKNLRVC DCHLF+KLVS++VDR+ V+RDATRFHHFK+G CSCKDYW Sbjct: 572 INTEPGTEITVIKNLRVCGDCHLFLKLVSEIVDRQLVVRDATRFHHFKNGVCSCKDYW 629 >emb|CBI30310.3| unnamed protein product [Vitis vinifera] Length = 543 Score = 108 bits (269), Expect = 1e-21 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 +NTE GTEI VIKNLRVC DCHLF+KLVS++VDR+ V+RDATRFHHFK+G CSCKDYW Sbjct: 486 INTEPGTEITVIKNLRVCGDCHLFLKLVSEIVDRQLVVRDATRFHHFKNGVCSCKDYW 543 >ref|XP_004305658.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Fragaria vesca subsp. vesca] Length = 608 Score = 107 bits (268), Expect = 1e-21 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LNTE GTEIVVIKNLRVC DCHLF+K +SK+V R+FV+RDATRFHHF++G CSCKDYW Sbjct: 551 LNTEPGTEIVVIKNLRVCADCHLFIKSISKIVQRQFVVRDATRFHHFRNGICSCKDYW 608 >ref|XP_003537073.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Glycine max] Length = 630 Score = 107 bits (267), Expect = 2e-21 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LNT+ GTEI V+KNLRVC DCHLF+KLVSK+V+R+F++RDATRFHHF+DG CSCKDYW Sbjct: 573 LNTKSGTEITVMKNLRVCVDCHLFIKLVSKIVNRQFIVRDATRFHHFRDGICSCKDYW 630 >ref|XP_002882733.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297328573|gb|EFH58992.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 620 Score = 107 bits (267), Expect = 2e-21 Identities = 46/58 (79%), Positives = 54/58 (93%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LN+ GTEI+VIKNLRVC DCH+F+KLVSK+VDRRFV+RDA+RFH+FKDG CSCKDYW Sbjct: 563 LNSIPGTEILVIKNLRVCEDCHVFIKLVSKIVDRRFVVRDASRFHYFKDGVCSCKDYW 620 >ref|XP_006407445.1| hypothetical protein EUTSA_v10022435mg [Eutrema salsugineum] gi|557108591|gb|ESQ48898.1| hypothetical protein EUTSA_v10022435mg [Eutrema salsugineum] Length = 625 Score = 107 bits (266), Expect = 2e-21 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LNTE GTEI+VIKNLR C +CH+F+K+VSK+VDRRFV+RDA+RFH+FKDG CSCKDYW Sbjct: 568 LNTEPGTEILVIKNLRACENCHVFIKMVSKIVDRRFVVRDASRFHYFKDGFCSCKDYW 625 >ref|XP_006299290.1| hypothetical protein CARUB_v10015444mg [Capsella rubella] gi|482567999|gb|EOA32188.1| hypothetical protein CARUB_v10015444mg [Capsella rubella] Length = 623 Score = 105 bits (262), Expect = 7e-21 Identities = 46/58 (79%), Positives = 54/58 (93%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LN+ GTEI+VIKNLRVC DCH+F+KLVSK+VDR+FVIRDA+RFH+FKDG CSCKDYW Sbjct: 566 LNSIPGTEILVIKNLRVCEDCHVFIKLVSKIVDRQFVIRDASRFHYFKDGFCSCKDYW 623 >ref|XP_004494044.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Cicer arietinum] Length = 641 Score = 105 bits (261), Expect = 9e-21 Identities = 43/58 (74%), Positives = 53/58 (91%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LNT GT+I V+KNLRVC DCH+F+KLVSK+VDR+F++RDATRFHHF++G CSCKDYW Sbjct: 584 LNTRSGTDITVMKNLRVCVDCHVFIKLVSKIVDRQFIVRDATRFHHFRNGVCSCKDYW 641 >ref|NP_187753.1| mitochondrial RNA editing factor 10 [Arabidopsis thaliana] gi|75169981|sp|Q9CAY1.1|PP223_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g11460 gi|12322902|gb|AAG51440.1|AC008153_13 hypothetical protein; 50785-52656 [Arabidopsis thaliana] gi|332641528|gb|AEE75049.1| mitochondrial RNA editing factor 10 [Arabidopsis thaliana] Length = 623 Score = 103 bits (258), Expect = 2e-20 Identities = 44/58 (75%), Positives = 53/58 (91%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LN+ GTEI+VIKNLRVC DCH+F+K VSK+VDR+FV+RDA+RFH+FKDG CSCKDYW Sbjct: 566 LNSIPGTEILVIKNLRVCEDCHVFLKQVSKIVDRQFVVRDASRFHYFKDGVCSCKDYW 623 >ref|XP_006341234.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Solanum tuberosum] Length = 646 Score = 103 bits (257), Expect = 3e-20 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LNTE+GT+I+VIKNLR+C DCH F+K VSK+VDR FV+RD TRFHHF++G CSC DYW Sbjct: 589 LNTEIGTDILVIKNLRICNDCHSFVKRVSKIVDRLFVVRDVTRFHHFRNGTCSCNDYW 646 >ref|XP_007144843.1| hypothetical protein PHAVU_007G188900g [Phaseolus vulgaris] gi|561018033|gb|ESW16837.1| hypothetical protein PHAVU_007G188900g [Phaseolus vulgaris] Length = 626 Score = 103 bits (257), Expect = 3e-20 Identities = 43/58 (74%), Positives = 53/58 (91%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LN++ GTEI V+KNLRVC CHLF+KLVSK+V+R+F++RDATRFHHF+DG CSCKDYW Sbjct: 569 LNSKSGTEITVMKNLRVCVHCHLFIKLVSKIVNRQFIVRDATRFHHFRDGVCSCKDYW 626 >ref|XP_004246502.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Solanum lycopersicum] Length = 643 Score = 102 bits (254), Expect = 6e-20 Identities = 43/58 (74%), Positives = 50/58 (86%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LNT +GT+IVVIKNLR+C DCH F+K VSK VDR FV+RDATRFHHF++G CSC DYW Sbjct: 586 LNTGIGTDIVVIKNLRICNDCHSFVKRVSKTVDRLFVVRDATRFHHFRNGTCSCNDYW 643 >ref|XP_004156253.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Cucumis sativus] Length = 614 Score = 101 bits (252), Expect = 1e-19 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LNT G E+V+IKNLR+C DCHLF K+VSK+V R+ +RDATRFHHF++G+CSCKDYW Sbjct: 557 LNTTTGAEVVIIKNLRICEDCHLFFKMVSKIVHRQLTVRDATRFHHFRNGSCSCKDYW 614 >ref|XP_004143385.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Cucumis sativus] Length = 623 Score = 101 bits (252), Expect = 1e-19 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LNT G E+V+IKNLR+C DCHLF K+VSK+V R+ +RDATRFHHF++G+CSCKDYW Sbjct: 566 LNTTTGAEVVIIKNLRICEDCHLFFKMVSKIVHRQLTVRDATRFHHFRNGSCSCKDYW 623 >ref|NP_001044643.1| Os01g0819800 [Oryza sativa Japonica Group] gi|21104789|dbj|BAB93376.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|113534174|dbj|BAF06557.1| Os01g0819800 [Oryza sativa Japonica Group] Length = 646 Score = 97.1 bits (240), Expect = 2e-18 Identities = 40/58 (68%), Positives = 51/58 (87%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LNTE G+EIVVIKNLRVC DCH F+K +S+L +R F++RDA+RFH F++GACSC+DYW Sbjct: 589 LNTEAGSEIVVIKNLRVCGDCHSFLKTISELTNRAFLVRDASRFHRFENGACSCRDYW 646 >gb|EAZ35608.1| hypothetical protein OsJ_19898 [Oryza sativa Japonica Group] Length = 602 Score = 97.1 bits (240), Expect = 2e-18 Identities = 40/58 (68%), Positives = 51/58 (87%) Frame = +2 Query: 2 LNTEVGTEIVVIKNLRVCRDCHLFMKLVSKLVDRRFVIRDATRFHHFKDGACSCKDYW 175 LNTE G+EIVVIKNLRVC DCH F+K +S+L +R F++RDA+RFH F++GACSC+DYW Sbjct: 545 LNTEAGSEIVVIKNLRVCGDCHSFLKTISELTNRAFLVRDASRFHRFENGACSCRDYW 602