BLASTX nr result
ID: Paeonia24_contig00037881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00037881 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263297.1| PREDICTED: pentatricopeptide repeat-containi... 149 5e-34 ref|XP_007213606.1| hypothetical protein PRUPE_ppa002332mg [Prun... 141 1e-31 ref|XP_006344817.1| PREDICTED: pentatricopeptide repeat-containi... 139 5e-31 ref|XP_004233414.1| PREDICTED: pentatricopeptide repeat-containi... 139 5e-31 ref|XP_003622422.1| Pentatricopeptide repeat-containing protein ... 134 1e-29 ref|XP_003545909.1| PREDICTED: pentatricopeptide repeat-containi... 133 2e-29 ref|XP_003623854.1| Pentatricopeptide repeat-containing protein ... 133 2e-29 gb|ABN08240.1| Tetratricopeptide-like helical [Medicago truncatula] 133 2e-29 gb|EYU44325.1| hypothetical protein MIMGU_mgv1a002336mg [Mimulus... 132 4e-29 ref|XP_002512769.1| pentatricopeptide repeat-containing protein,... 130 1e-28 ref|XP_004488881.1| PREDICTED: pentatricopeptide repeat-containi... 130 2e-28 ref|XP_003596605.1| Pentatricopeptide repeat-containing protein ... 129 4e-28 ref|XP_003596573.1| Pentatricopeptide repeat-containing protein ... 129 4e-28 ref|XP_004490231.1| PREDICTED: pentatricopeptide repeat-containi... 127 2e-27 ref|XP_007149271.1| hypothetical protein PHAVU_005G056200g [Phas... 126 3e-27 ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citr... 122 5e-26 ref|XP_002302000.2| pentatricopeptide repeat-containing family p... 119 3e-25 ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containi... 119 4e-25 gb|AEX11932.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|... 117 2e-24 ref|XP_004301492.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 >ref|XP_002263297.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] gi|297736133|emb|CBI24171.3| unnamed protein product [Vitis vinifera] Length = 687 Score = 149 bits (375), Expect = 5e-34 Identities = 68/74 (91%), Positives = 72/74 (97%) Frame = -2 Query: 256 EILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRF 77 E+LCNHSEKLAVAFG+LNLNG SSIRVFKNLRICGDCHNAIKFMAKIVGV+IIVRDSLRF Sbjct: 614 EVLCNHSEKLAVAFGVLNLNGESSIRVFKNLRICGDCHNAIKFMAKIVGVKIIVRDSLRF 673 Query: 76 HHFRDGLCSCGEFW 35 HHFRDGLCSC +FW Sbjct: 674 HHFRDGLCSCQDFW 687 >ref|XP_007213606.1| hypothetical protein PRUPE_ppa002332mg [Prunus persica] gi|462409471|gb|EMJ14805.1| hypothetical protein PRUPE_ppa002332mg [Prunus persica] Length = 686 Score = 141 bits (355), Expect = 1e-31 Identities = 65/73 (89%), Positives = 69/73 (94%) Frame = -2 Query: 253 ILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRFH 74 ILCNHSEKLAVAFGILNLNG S+IRVFKNLRICGDCHNAIKFM KIVGV+IIVRDSLRFH Sbjct: 614 ILCNHSEKLAVAFGILNLNGESTIRVFKNLRICGDCHNAIKFMGKIVGVQIIVRDSLRFH 673 Query: 73 HFRDGLCSCGEFW 35 HF+DG CSC +FW Sbjct: 674 HFKDGDCSCRDFW 686 >ref|XP_006344817.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum tuberosum] Length = 686 Score = 139 bits (349), Expect = 5e-31 Identities = 62/72 (86%), Positives = 69/72 (95%) Frame = -2 Query: 250 LCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRFHH 71 LCNHSE+LAVAFGILNL+G SSIRVFKNLRICGDCHNAIK++AKIVGV+IIVRD LRFHH Sbjct: 615 LCNHSERLAVAFGILNLDGASSIRVFKNLRICGDCHNAIKYLAKIVGVQIIVRDPLRFHH 674 Query: 70 FRDGLCSCGEFW 35 F+DGLCSC +FW Sbjct: 675 FKDGLCSCRDFW 686 >ref|XP_004233414.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 685 Score = 139 bits (349), Expect = 5e-31 Identities = 62/72 (86%), Positives = 69/72 (95%) Frame = -2 Query: 250 LCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRFHH 71 LCNHSE+LAVAFGILNL+G SSIRVFKNLRICGDCHNAIK++AKIVGV+IIVRD LRFHH Sbjct: 614 LCNHSERLAVAFGILNLDGASSIRVFKNLRICGDCHNAIKYLAKIVGVQIIVRDPLRFHH 673 Query: 70 FRDGLCSCGEFW 35 F+DGLCSC +FW Sbjct: 674 FKDGLCSCRDFW 685 >ref|XP_003622422.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355497437|gb|AES78640.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 952 Score = 134 bits (338), Expect = 1e-29 Identities = 60/74 (81%), Positives = 68/74 (91%) Frame = -2 Query: 256 EILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRF 77 E LCNHSEKLAVAFGILNLNG S+IRVFKNLRICGDCHNAIK+M+ +VGV I+VRDSLRF Sbjct: 879 ESLCNHSEKLAVAFGILNLNGQSTIRVFKNLRICGDCHNAIKYMSNVVGVTIVVRDSLRF 938 Query: 76 HHFRDGLCSCGEFW 35 HHF++G CSC +FW Sbjct: 939 HHFKNGNCSCKDFW 952 >ref|XP_003545909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Glycine max] Length = 741 Score = 133 bits (335), Expect = 2e-29 Identities = 61/74 (82%), Positives = 68/74 (91%) Frame = -2 Query: 256 EILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRF 77 E LC+HSEKLAVAFGILNLNG SSIRVFKNLRICGDCHNAIK+++K+VGV IIVRDSLRF Sbjct: 668 ESLCSHSEKLAVAFGILNLNGQSSIRVFKNLRICGDCHNAIKYVSKVVGVTIIVRDSLRF 727 Query: 76 HHFRDGLCSCGEFW 35 HHFR+G CSC + W Sbjct: 728 HHFRNGNCSCQDLW 741 >ref|XP_003623854.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498869|gb|AES80072.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 865 Score = 133 bits (335), Expect = 2e-29 Identities = 60/74 (81%), Positives = 68/74 (91%) Frame = -2 Query: 256 EILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRF 77 E LCNHSEKLAVAFGILNLNG S+IRVFKNLRICGDCHNAIK+M+K+VGV I+VRDSLRF Sbjct: 700 ESLCNHSEKLAVAFGILNLNGQSTIRVFKNLRICGDCHNAIKYMSKVVGVIIVVRDSLRF 759 Query: 76 HHFRDGLCSCGEFW 35 HHF++G CSC + W Sbjct: 760 HHFKNGNCSCKDLW 773 >gb|ABN08240.1| Tetratricopeptide-like helical [Medicago truncatula] Length = 687 Score = 133 bits (335), Expect = 2e-29 Identities = 60/74 (81%), Positives = 68/74 (91%) Frame = -2 Query: 256 EILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRF 77 E LCNHSEKLAVAFGILNLNG S+IRVFKNLRICGDCHNAIK+M+K+VGV I+VRDSLRF Sbjct: 614 ESLCNHSEKLAVAFGILNLNGQSTIRVFKNLRICGDCHNAIKYMSKVVGVIIVVRDSLRF 673 Query: 76 HHFRDGLCSCGEFW 35 HHF++G CSC + W Sbjct: 674 HHFKNGNCSCKDLW 687 >gb|EYU44325.1| hypothetical protein MIMGU_mgv1a002336mg [Mimulus guttatus] Length = 687 Score = 132 bits (333), Expect = 4e-29 Identities = 58/72 (80%), Positives = 66/72 (91%) Frame = -2 Query: 250 LCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRFHH 71 LCNHSEKLAVAFGIL+L G SS+ VFKNLRICGDCH+ IKF+AK VGV++IVRDSLRFHH Sbjct: 616 LCNHSEKLAVAFGILHLKGESSVTVFKNLRICGDCHSTIKFIAKFVGVQVIVRDSLRFHH 675 Query: 70 FRDGLCSCGEFW 35 F DG+CSCG+FW Sbjct: 676 FTDGICSCGDFW 687 >ref|XP_002512769.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547780|gb|EEF49272.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 684 Score = 130 bits (328), Expect = 1e-28 Identities = 57/74 (77%), Positives = 68/74 (91%) Frame = -2 Query: 256 EILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRF 77 E LC+HSE+LAVAFGILN +G +++RVFKNLRICGDCHNAIK +AKIVG++IIVRDSLRF Sbjct: 611 ETLCSHSERLAVAFGILNSSGKTTVRVFKNLRICGDCHNAIKLIAKIVGMQIIVRDSLRF 670 Query: 76 HHFRDGLCSCGEFW 35 HHFRDG C+C +FW Sbjct: 671 HHFRDGYCTCNDFW 684 >ref|XP_004488881.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like, partial [Cicer arietinum] Length = 721 Score = 130 bits (327), Expect = 2e-28 Identities = 58/74 (78%), Positives = 67/74 (90%) Frame = -2 Query: 256 EILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRF 77 E LCN SEKLAVAFG+LNLNG S+IRVFKNLRICGDCHNAIK+M+K+VGV I+VRDSLRF Sbjct: 648 ESLCNQSEKLAVAFGMLNLNGQSTIRVFKNLRICGDCHNAIKYMSKVVGVMIVVRDSLRF 707 Query: 76 HHFRDGLCSCGEFW 35 HHF++G CSC + W Sbjct: 708 HHFKNGNCSCNDLW 721 >ref|XP_003596605.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355485653|gb|AES66856.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 616 Score = 129 bits (324), Expect = 4e-28 Identities = 58/74 (78%), Positives = 65/74 (87%) Frame = -2 Query: 256 EILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRF 77 E LC HSEKLAVAFGILNLNG S+IRVFKNLRICGDCHNAIK+MAK+V V I+VRDS RF Sbjct: 543 ESLCKHSEKLAVAFGILNLNGQSTIRVFKNLRICGDCHNAIKYMAKVVDVMIVVRDSFRF 602 Query: 76 HHFRDGLCSCGEFW 35 HHF++G CSC + W Sbjct: 603 HHFKNGNCSCNDLW 616 >ref|XP_003596573.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355485621|gb|AES66824.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 344 Score = 129 bits (324), Expect = 4e-28 Identities = 58/74 (78%), Positives = 65/74 (87%) Frame = -2 Query: 256 EILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRF 77 E LC HSEKLAVAFGILNLNG S+IRVFKNLRICGDCHNAIK+MAK+V V I+VRDS RF Sbjct: 271 ESLCKHSEKLAVAFGILNLNGQSTIRVFKNLRICGDCHNAIKYMAKVVDVMIVVRDSFRF 330 Query: 76 HHFRDGLCSCGEFW 35 HHF++G CSC + W Sbjct: 331 HHFKNGNCSCNDLW 344 >ref|XP_004490231.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like, partial [Cicer arietinum] Length = 706 Score = 127 bits (318), Expect = 2e-27 Identities = 57/72 (79%), Positives = 66/72 (91%) Frame = -2 Query: 256 EILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRF 77 E LCNHSEKLAVAFG+LNLNG S+IRVFKNLRICGDCHNAIK+M+ +VGV I+VRDSLRF Sbjct: 628 ESLCNHSEKLAVAFGMLNLNGQSTIRVFKNLRICGDCHNAIKYMSMVVGVMIVVRDSLRF 687 Query: 76 HHFRDGLCSCGE 41 HHF++G CSC + Sbjct: 688 HHFKNGNCSCND 699 >ref|XP_007149271.1| hypothetical protein PHAVU_005G056200g [Phaseolus vulgaris] gi|561022535|gb|ESW21265.1| hypothetical protein PHAVU_005G056200g [Phaseolus vulgaris] Length = 579 Score = 126 bits (317), Expect = 3e-27 Identities = 56/72 (77%), Positives = 66/72 (91%) Frame = -2 Query: 250 LCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRFHH 71 LC+HSE+LAVAFGILNLNG SSIRVFKNLRICGDCH+ IK+++K+VG+ IIVRDSLRFHH Sbjct: 508 LCSHSERLAVAFGILNLNGQSSIRVFKNLRICGDCHSVIKYISKVVGMTIIVRDSLRFHH 567 Query: 70 FRDGLCSCGEFW 35 FR+G CSC + W Sbjct: 568 FRNGNCSCQDLW 579 >ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citrus clementina] gi|557537225|gb|ESR48343.1| hypothetical protein CICLE_v10000322mg [Citrus clementina] Length = 799 Score = 122 bits (306), Expect = 5e-26 Identities = 52/72 (72%), Positives = 62/72 (86%) Frame = -2 Query: 250 LCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRFHH 71 L HSEKLAVAFG++ L GG+++RV KNLRICGDCHNA KFM+K+VG EI+VRD RFHH Sbjct: 728 LSTHSEKLAVAFGLMKLPGGATVRVLKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHH 787 Query: 70 FRDGLCSCGEFW 35 FRDG CSCG++W Sbjct: 788 FRDGKCSCGDYW 799 >ref|XP_002302000.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344162|gb|EEE81273.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 797 Score = 119 bits (299), Expect = 3e-25 Identities = 51/72 (70%), Positives = 61/72 (84%) Frame = -2 Query: 250 LCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRFHH 71 L HSEKLAVA+G + L G+++RVFKNLRICGDCHNA KFM+K+VG EI+VRD RFHH Sbjct: 726 LSTHSEKLAVAYGFMKLPHGATVRVFKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHH 785 Query: 70 FRDGLCSCGEFW 35 FRDG CSCG++W Sbjct: 786 FRDGKCSCGDYW 797 >ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like isoform X1 [Citrus sinensis] gi|568839239|ref|XP_006473596.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like isoform X2 [Citrus sinensis] Length = 799 Score = 119 bits (298), Expect = 4e-25 Identities = 51/72 (70%), Positives = 61/72 (84%) Frame = -2 Query: 250 LCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRFHH 71 L HSEKLAVAFG++ L G+++RV KNLRICGDCHNA KFM+K+VG EI+VRD RFHH Sbjct: 728 LSTHSEKLAVAFGLMKLPHGATVRVLKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHH 787 Query: 70 FRDGLCSCGEFW 35 FRDG CSCG++W Sbjct: 788 FRDGKCSCGDYW 799 >gb|AEX11932.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063454|gb|AEX11934.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063456|gb|AEX11935.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063458|gb|AEX11936.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063460|gb|AEX11937.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063462|gb|AEX11938.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063464|gb|AEX11939.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063466|gb|AEX11940.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063468|gb|AEX11941.1| hypothetical protein 0_18068_02 [Pinus taeda] gi|367063470|gb|AEX11942.1| hypothetical protein 0_18068_02 [Pinus taeda] Length = 80 Score = 117 bits (293), Expect = 2e-24 Identities = 50/73 (68%), Positives = 62/73 (84%) Frame = -2 Query: 253 ILCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRFH 74 ILC+HSEKLA++FGI+N N G+ IR+ KNLR+C DCHNA F++KIVG EIIVRD+ RFH Sbjct: 8 ILCSHSEKLAISFGIINTNPGTPIRIMKNLRVCNDCHNATTFISKIVGREIIVRDANRFH 67 Query: 73 HFRDGLCSCGEFW 35 HF+ GLCSCG +W Sbjct: 68 HFKAGLCSCGGYW 80 >ref|XP_004301492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like, partial [Fragaria vesca subsp. vesca] Length = 800 Score = 117 bits (292), Expect = 2e-24 Identities = 51/72 (70%), Positives = 62/72 (86%) Frame = -2 Query: 250 LCNHSEKLAVAFGILNLNGGSSIRVFKNLRICGDCHNAIKFMAKIVGVEIIVRDSLRFHH 71 L HSEKLAVAFGI+ L G++IRVFKNLRICGDCHNA K+M+++VG EI+VRD+ RFHH Sbjct: 729 LSTHSEKLAVAFGIMKLPLGATIRVFKNLRICGDCHNAFKYMSRVVGREIVVRDAKRFHH 788 Query: 70 FRDGLCSCGEFW 35 FR+G CSCG +W Sbjct: 789 FRNGECSCGNYW 800