BLASTX nr result
ID: Paeonia24_contig00037851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00037851 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007219089.1| hypothetical protein PRUPE_ppa015100mg, part... 42 3e-06 >ref|XP_007219089.1| hypothetical protein PRUPE_ppa015100mg, partial [Prunus persica] gi|462415551|gb|EMJ20288.1| hypothetical protein PRUPE_ppa015100mg, partial [Prunus persica] Length = 641 Score = 41.6 bits (96), Expect(2) = 3e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -1 Query: 118 LVGRDSRLLNLGLDHTSITEFEEIKKLIQHLLQQGVI 8 LVG DS L NLGL TS+ E +EIKK IQ LL+QGVI Sbjct: 153 LVG-DSPLPNLGLYRTSLMESDEIKKQIQGLLEQGVI 188 Score = 35.0 bits (79), Expect(2) = 3e-06 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Frame = -2 Query: 219 STTETVARDLGVCKQNFQ---RDVKGMPPRRAAEHGI*LVG 106 S + T D+G ++ F+ DV+G+PP+RA EH I LVG Sbjct: 115 SLSPTQCSDIGKLQEKFKDLFHDVQGLPPQRAIEHEIQLVG 155