BLASTX nr result
ID: Paeonia24_contig00037593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00037593 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007220270.1| hypothetical protein PRUPE_ppa001067mg [Prun... 62 1e-07 ref|XP_006436163.1| hypothetical protein CICLE_v10030639mg [Citr... 60 3e-07 ref|XP_002315264.2| hypothetical protein POPTR_0010s22140g [Popu... 60 4e-07 ref|XP_004307442.1| PREDICTED: uncharacterized protein LOC101314... 59 5e-07 >ref|XP_007220270.1| hypothetical protein PRUPE_ppa001067mg [Prunus persica] gi|462416732|gb|EMJ21469.1| hypothetical protein PRUPE_ppa001067mg [Prunus persica] Length = 919 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = -3 Query: 222 GDTCGGLNNIGTESGVDVQLRRKLKKADEKIMFLSEELQQETFF*DAGYH 73 GD C GLN T+ +DV+L R+LK+A+E +M LSEEL+QE+F D+GY+ Sbjct: 312 GDNCDGLNTDETQEDMDVELERRLKEAEENVMLLSEELEQESFLRDSGYN 361 >ref|XP_006436163.1| hypothetical protein CICLE_v10030639mg [Citrus clementina] gi|568865220|ref|XP_006485975.1| PREDICTED: cingulin-like protein 1-like isoform X1 [Citrus sinensis] gi|568865222|ref|XP_006485976.1| PREDICTED: cingulin-like protein 1-like isoform X2 [Citrus sinensis] gi|557538359|gb|ESR49403.1| hypothetical protein CICLE_v10030639mg [Citrus clementina] Length = 961 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = -3 Query: 228 FLGDTCGGLNNIGTESGVDVQLRRKLKKADEKIMFLSEELQQETFF*DAGY 76 F GD C GLN+I TE DV+LRR+ K+A+ ++M LSEEL+ ETF D G+ Sbjct: 340 FYGDHCEGLNSIETEEDEDVELRRRSKEAEGRVMVLSEELEHETFLHDTGF 390 >ref|XP_002315264.2| hypothetical protein POPTR_0010s22140g [Populus trichocarpa] gi|550330349|gb|EEF01435.2| hypothetical protein POPTR_0010s22140g [Populus trichocarpa] Length = 954 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/51 (50%), Positives = 41/51 (80%) Frame = -3 Query: 228 FLGDTCGGLNNIGTESGVDVQLRRKLKKADEKIMFLSEELQQETFF*DAGY 76 FLGD G +N++G++ VDV+L+R+ K+A+E+I LSEEL+QE+F D+G+ Sbjct: 334 FLGDDFGDMNSVGSDDMVDVELQRRSKEAEERIALLSEELEQESFLQDSGF 384 >ref|XP_004307442.1| PREDICTED: uncharacterized protein LOC101314699 [Fragaria vesca subsp. vesca] Length = 884 Score = 58.9 bits (141), Expect(2) = 5e-07 Identities = 26/52 (50%), Positives = 39/52 (75%) Frame = -3 Query: 228 FLGDTCGGLNNIGTESGVDVQLRRKLKKADEKIMFLSEELQQETFF*DAGYH 73 F G+ C GLN+ +DV+L+R+L++A+EK+M LSEEL+QE+F D GY+ Sbjct: 271 FYGEKCNGLNSDEIGEDLDVELQRRLEEAEEKVMILSEELEQESFLRDTGYN 322 Score = 20.4 bits (41), Expect(2) = 5e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -2 Query: 67 LIQTIRNLIE 38 LIQTIRNL E Sbjct: 326 LIQTIRNLTE 335