BLASTX nr result
ID: Paeonia24_contig00037363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00037363 (210 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310970.1| hypothetical protein POPTR_0008s01390g [Popu... 56 5e-06 >ref|XP_002310970.1| hypothetical protein POPTR_0008s01390g [Populus trichocarpa] gi|222850790|gb|EEE88337.1| hypothetical protein POPTR_0008s01390g [Populus trichocarpa] Length = 421 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = +2 Query: 2 SKTKLPDRFTWLHVHQTWLEESRMNDQTTWLF 97 SK +PD FTW+H+HQTWLE S DQTTWLF Sbjct: 390 SKANVPDGFTWMHMHQTWLEGSEPKDQTTWLF 421