BLASTX nr result
ID: Paeonia24_contig00036824
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00036824 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago ... 72 2e-12 >ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago truncatula] gi|355477312|gb|AES58515.1| hypothetical protein MTR_1g005050 [Medicago truncatula] Length = 334 Score = 72.0 bits (175), Expect(2) = 2e-12 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +1 Query: 160 PEFRPDRTLLCLSCSHARRPEDLSCPGLDKYVEIFVGPWNKNNRYF 297 P D+TLL LSCSHARRPEDLSCPGLDKYVEIFVGP ++ F Sbjct: 144 PGLNSDQTLLYLSCSHARRPEDLSCPGLDKYVEIFVGPGRESQSIF 189 Score = 25.8 bits (55), Expect(2) = 2e-12 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 285 QSIFSRIPYHATHGDLSIDR 344 QSIFSRIPYH +S R Sbjct: 186 QSIFSRIPYHLFISPVSFRR 205