BLASTX nr result
ID: Paeonia24_contig00036264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00036264 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007201264.1| hypothetical protein PRUPE_ppa010824mg [Prun... 55 8e-06 >ref|XP_007201264.1| hypothetical protein PRUPE_ppa010824mg [Prunus persica] gi|462396664|gb|EMJ02463.1| hypothetical protein PRUPE_ppa010824mg [Prunus persica] Length = 234 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = +3 Query: 3 GSLNSPATALVGTIQAPAREVVMVLKAYVKKL 98 G+LNSPA++LVGTIQAPARE+VM+LKAYV+KL Sbjct: 195 GTLNSPASSLVGTIQAPARELVMLLKAYVQKL 226