BLASTX nr result
ID: Paeonia24_contig00036069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00036069 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containi... 184 1e-44 ref|XP_002317023.2| hypothetical protein POPTR_0011s14750g [Popu... 178 6e-43 ref|XP_002513427.1| pentatricopeptide repeat-containing protein,... 177 1e-42 gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucu... 176 4e-42 ref|XP_007213918.1| hypothetical protein PRUPE_ppa004201mg [Prun... 175 5e-42 ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containi... 175 5e-42 ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containi... 175 5e-42 ref|XP_004294203.1| PREDICTED: pentatricopeptide repeat-containi... 174 1e-41 gb|EYU27532.1| hypothetical protein MIMGU_mgv1a003642mg [Mimulus... 173 2e-41 ref|XP_007022279.1| Pentatricopeptide repeat (PPR) superfamily p... 173 2e-41 ref|XP_002300545.1| pentatricopeptide repeat-containing family p... 173 2e-41 ref|XP_006478018.1| PREDICTED: pentatricopeptide repeat-containi... 171 8e-41 ref|XP_006441032.1| hypothetical protein CICLE_v10019503mg [Citr... 171 8e-41 ref|XP_006585428.1| PREDICTED: pentatricopeptide repeat-containi... 164 2e-38 ref|XP_006346048.1| PREDICTED: pentatricopeptide repeat-containi... 164 2e-38 ref|XP_004243988.1| PREDICTED: pentatricopeptide repeat-containi... 164 2e-38 ref|XP_003531505.1| PREDICTED: pentatricopeptide repeat-containi... 164 2e-38 ref|XP_006598186.1| PREDICTED: pentatricopeptide repeat-containi... 163 2e-38 ref|XP_006836423.1| hypothetical protein AMTR_s00092p00157010 [A... 163 2e-38 ref|XP_004488838.1| PREDICTED: pentatricopeptide repeat-containi... 163 3e-38 >ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Vitis vinifera] gi|147852271|emb|CAN82234.1| hypothetical protein VITISV_038804 [Vitis vinifera] Length = 567 Score = 184 bits (467), Expect = 1e-44 Identities = 83/108 (76%), Positives = 101/108 (93%) Frame = -2 Query: 325 HKPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAM 146 HKPD QATQL+Y+LCKS+KMRKAT+VME+M+ SGT P+ ASCTFLVN+LC+RGNVGYAM Sbjct: 93 HKPDGGQATQLMYELCKSNKMRKATKVMELMIGSGTTPDPASCTFLVNNLCKRGNVGYAM 152 Query: 145 QLVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 QLVE++E+YGYPTNTV YNSLVRGLCMHGNL+QSLQ+LD+ M+KG++P Sbjct: 153 QLVEKMEEYGYPTNTVTYNSLVRGLCMHGNLSQSLQILDKFMKKGLVP 200 >ref|XP_002317023.2| hypothetical protein POPTR_0011s14750g [Populus trichocarpa] gi|550328410|gb|EEE97635.2| hypothetical protein POPTR_0011s14750g [Populus trichocarpa] Length = 567 Score = 178 bits (452), Expect = 6e-43 Identities = 84/108 (77%), Positives = 98/108 (90%) Frame = -2 Query: 325 HKPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAM 146 HKPDV QATQLLYDLCKS+KM+KATRVMEMM+ SG P+ AS TFLVN+LC+RGN+G+AM Sbjct: 93 HKPDVAQATQLLYDLCKSNKMKKATRVMEMMIESGIIPDAASYTFLVNNLCKRGNIGHAM 152 Query: 145 QLVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 QLVE++E+ GYPTNTV YNSLVRGLCMHGNL QSLQLLD+LM KG++P Sbjct: 153 QLVEKMEENGYPTNTVTYNSLVRGLCMHGNLNQSLQLLDKLMWKGLVP 200 >ref|XP_002513427.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547335|gb|EEF48830.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 177 bits (450), Expect = 1e-42 Identities = 83/108 (76%), Positives = 95/108 (87%) Frame = -2 Query: 325 HKPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAM 146 HKPDV QATQLLYDLCKS+KM+KA RVMEMM+ G P+ AS TFLVNHLC+RGNVGYAM Sbjct: 93 HKPDVVQATQLLYDLCKSNKMKKAIRVMEMMISCGIIPDAASYTFLVNHLCKRGNVGYAM 152 Query: 145 QLVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 QLVE++ED GYP NTV YN+LV+GLCMHGNL +SLQ LDRLMQKG++P Sbjct: 153 QLVEKMEDSGYPANTVTYNTLVKGLCMHGNLNKSLQFLDRLMQKGLVP 200 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/101 (28%), Positives = 51/101 (50%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 +P++ LL LCK ++ +A R+ + + G +P + S L+ LC G A + Sbjct: 234 QPNLVSYNVLLTGLCKEGRIEEAIRLFKNLPSKGFSPNVVSYNILLRSLCYEGRWEEANE 293 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLM 20 L+ + + V YN L+ L HG + Q+LQ++D +M Sbjct: 294 LLAEMNGRERSPSIVTYNILIGSLAFHGKIEQALQVIDEMM 334 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/96 (30%), Positives = 49/96 (51%) Frame = -2 Query: 319 PDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQL 140 P+ + LL K + +A R+++ ++ G P L S L+ LC+ G + A++L Sbjct: 200 PNAFTYSSLLEAAYKERGVNEAMRLLDEIIAKGGQPNLVSYNVLLTGLCKEGRIEEAIRL 259 Query: 139 VERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLL 32 + L G+ N V YN L+R LC G ++ +LL Sbjct: 260 FKNLPSKGFSPNVVSYNILLRSLCYEGRWEEANELL 295 >gb|ADN33755.1| pentatricopeptide repeat-containing protein [Cucumis melo subsp. melo] Length = 566 Score = 176 bits (445), Expect = 4e-42 Identities = 83/107 (77%), Positives = 97/107 (90%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KPDV QATQLLYDLCK+ KMRKA +VMEMM+ SG P+ +S TFLV+ LCR+GNVGYAMQ Sbjct: 94 KPDVFQATQLLYDLCKACKMRKAIKVMEMMIGSGIIPDASSYTFLVSSLCRKGNVGYAMQ 153 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LV+++E+YGYPTNTV YNSLVRGLCMHGNLTQSLQLLDRL+QKG++P Sbjct: 154 LVDKMEEYGYPTNTVTYNSLVRGLCMHGNLTQSLQLLDRLIQKGLVP 200 >ref|XP_007213918.1| hypothetical protein PRUPE_ppa004201mg [Prunus persica] gi|462409783|gb|EMJ15117.1| hypothetical protein PRUPE_ppa004201mg [Prunus persica] Length = 523 Score = 175 bits (444), Expect = 5e-42 Identities = 81/107 (75%), Positives = 97/107 (90%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KPDV QATQLLYDLCK++KMRKA RV+EMMV +G P+ AS TFLVN+LC+RGN+GYAMQ Sbjct: 94 KPDVAQATQLLYDLCKANKMRKAVRVIEMMVSAGIIPDAASYTFLVNYLCKRGNIGYAMQ 153 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LVE++E+YGYPTNT+ YNSLVRGLC+ GNL QSLQLLDRL+QKG++P Sbjct: 154 LVEKMEEYGYPTNTITYNSLVRGLCVRGNLNQSLQLLDRLIQKGLVP 200 >ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 175 bits (444), Expect = 5e-42 Identities = 83/107 (77%), Positives = 96/107 (89%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KPDV QATQLLYDLCK+ KMRKA +VMEMM+ SG P+ AS TFLV+ LCR+GNVGYAMQ Sbjct: 94 KPDVFQATQLLYDLCKTCKMRKAIKVMEMMIGSGIIPDAASYTFLVSSLCRKGNVGYAMQ 153 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LV+++E+YGYPTNT YNSLVRGLCMHGNLTQSLQLLDRL+QKG++P Sbjct: 154 LVDKMEEYGYPTNTATYNSLVRGLCMHGNLTQSLQLLDRLIQKGLVP 200 >ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 175 bits (444), Expect = 5e-42 Identities = 83/107 (77%), Positives = 96/107 (89%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KPDV QATQLLYDLCK+ KMRKA +VMEMM+ SG P+ AS TFLV+ LCR+GNVGYAMQ Sbjct: 94 KPDVFQATQLLYDLCKTCKMRKAIKVMEMMIGSGIIPDAASYTFLVSSLCRKGNVGYAMQ 153 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LV+++E+YGYPTNT YNSLVRGLCMHGNLTQSLQLLDRL+QKG++P Sbjct: 154 LVDKMEEYGYPTNTATYNSLVRGLCMHGNLTQSLQLLDRLIQKGLVP 200 >ref|XP_004294203.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 566 Score = 174 bits (441), Expect = 1e-41 Identities = 81/107 (75%), Positives = 96/107 (89%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KPDV QATQLLYDLCK+SKMRKA RVMEMMV SG P+ AS TFLVN+LC+RGN+GYAMQ Sbjct: 93 KPDVGQATQLLYDLCKASKMRKAMRVMEMMVASGIIPDAASYTFLVNYLCKRGNIGYAMQ 152 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LVE++E+YGYPTNT+ YNSLVRGLC+ GNL +SLQLLD+L+ KG++P Sbjct: 153 LVEKMEEYGYPTNTITYNSLVRGLCVRGNLNKSLQLLDKLIHKGLVP 199 >gb|EYU27532.1| hypothetical protein MIMGU_mgv1a003642mg [Mimulus guttatus] Length = 572 Score = 173 bits (439), Expect = 2e-41 Identities = 81/108 (75%), Positives = 96/108 (88%) Frame = -2 Query: 325 HKPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAM 146 HKPDV ATQL+YDLCKS+K+RKATRVMEM+V + T P+ AS TFLVNHLCRRGNVG+AM Sbjct: 94 HKPDVASATQLMYDLCKSNKLRKATRVMEMVVKASTIPDAASYTFLVNHLCRRGNVGHAM 153 Query: 145 QLVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 QLVE +E+YGYPTNT+ YNSLVRGLCM GNL +SLQ +++LMQKG+IP Sbjct: 154 QLVETMEEYGYPTNTLTYNSLVRGLCMRGNLNKSLQFVEKLMQKGLIP 201 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/104 (27%), Positives = 51/104 (49%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KP++ +L LCK ++ +A ++ + G NP + S L+ LC G A + Sbjct: 235 KPNLVSHNVILTGLCKENRTEEAVQLFRDLPAKGFNPNVVSYNILLRSLCYEGRWDEANE 294 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKG 11 L+ + + V YN L+ L + G Q+L++LD L ++G Sbjct: 295 LLSEMVGEERAPSIVTYNILIGSLALKGRTDQALEVLDELFREG 338 >ref|XP_007022279.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508721907|gb|EOY13804.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 568 Score = 173 bits (439), Expect = 2e-41 Identities = 81/107 (75%), Positives = 97/107 (90%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KPDV QATQLLYDLCK++KM+K+ RV+EMMV SG P+ AS TFLVNHLC+RGNVG+AMQ Sbjct: 94 KPDVAQATQLLYDLCKANKMKKSIRVLEMMVNSGIIPDAASYTFLVNHLCKRGNVGHAMQ 153 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LVE++E +GYPTNTV YNSLVRGLCMHGNL QSLQLLD+L+Q+G++P Sbjct: 154 LVEKMEAHGYPTNTVTYNSLVRGLCMHGNLNQSLQLLDKLIQRGLVP 200 >ref|XP_002300545.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222847803|gb|EEE85350.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 567 Score = 173 bits (439), Expect = 2e-41 Identities = 82/108 (75%), Positives = 96/108 (88%) Frame = -2 Query: 325 HKPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAM 146 HKPDV QATQLLYDLCKS+KM+KATRVMEM + SG P+ AS TFLVN+LC+RGN+GYAM Sbjct: 93 HKPDVAQATQLLYDLCKSNKMKKATRVMEMTIESGIIPDAASYTFLVNNLCKRGNIGYAM 152 Query: 145 QLVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 QLVE++E+ G PTNTV YNSLVRGLC HGNL QSLQLLD+LM+KG++P Sbjct: 153 QLVEKMEENGCPTNTVTYNSLVRGLCKHGNLNQSLQLLDKLMRKGLVP 200 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/107 (28%), Positives = 50/107 (46%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KP++ LL LCK + +A + + G NP + SC ++ LC G A + Sbjct: 234 KPNLVSYNVLLTGLCKEGRTEEAIQFFRDLPSKGFNPNVVSCNIILRSLCCEGRWEEANE 293 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LV ++ + V YN L+ L HG + + Q+LD +M+ P Sbjct: 294 LVAEMDSEERSPSLVTYNILIGSLASHGRIQHAFQVLDEMMRASFQP 340 >ref|XP_006478018.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Citrus sinensis] Length = 568 Score = 171 bits (434), Expect = 8e-41 Identities = 81/108 (75%), Positives = 95/108 (87%) Frame = -2 Query: 325 HKPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAM 146 HKPDV QAT LLYDLCK++KM+KA +VMEMMV SG P+ +S T+LVN LC++GNVGYAM Sbjct: 94 HKPDVVQATNLLYDLCKANKMKKAIKVMEMMVSSGIIPDASSYTYLVNCLCKKGNVGYAM 153 Query: 145 QLVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 QLVE++EDYGYPTNTV YNSLVRGLCM GNL QSLQ LDRL+QKG++P Sbjct: 154 QLVEKMEDYGYPTNTVTYNSLVRGLCMLGNLNQSLQFLDRLIQKGLVP 201 >ref|XP_006441032.1| hypothetical protein CICLE_v10019503mg [Citrus clementina] gi|557543294|gb|ESR54272.1| hypothetical protein CICLE_v10019503mg [Citrus clementina] Length = 568 Score = 171 bits (434), Expect = 8e-41 Identities = 81/108 (75%), Positives = 95/108 (87%) Frame = -2 Query: 325 HKPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAM 146 HKPDV QAT LLYDLCK++KM+KA +VMEMMV SG P+ +S T+LVN LC++GNVGYAM Sbjct: 94 HKPDVVQATNLLYDLCKANKMKKAIKVMEMMVSSGIIPDASSYTYLVNCLCKKGNVGYAM 153 Query: 145 QLVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 QLVE++EDYGYPTNTV YNSLVRGLCM GNL QSLQ LDRL+QKG++P Sbjct: 154 QLVEKMEDYGYPTNTVTYNSLVRGLCMLGNLNQSLQFLDRLIQKGLVP 201 >ref|XP_006585428.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like isoform X2 [Glycine max] Length = 405 Score = 164 bits (414), Expect = 2e-38 Identities = 79/107 (73%), Positives = 92/107 (85%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KP+V QATQLLYDLCK +K RKA RVMEMMV SG P+ AS T LVN LC+RGNVGYA+Q Sbjct: 96 KPEVNQATQLLYDLCKFNKARKAVRVMEMMVGSGIIPDAASYTHLVNFLCKRGNVGYAIQ 155 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LVE++E +G+PTNTV YN+LV+GLCMHGNL QSLQLLDRL +KG+IP Sbjct: 156 LVEKMEGHGFPTNTVTYNTLVKGLCMHGNLNQSLQLLDRLTKKGLIP 202 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/104 (25%), Positives = 52/104 (50%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 +P++ LL LCK + +A ++ + + G +P + S L+ LC G A + Sbjct: 236 EPNLVSYNVLLTGLCKEGRTEEAIKLFQELPVKGFSPSVVSFNILLRSLCYEGRWEEANE 295 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKG 11 L+ ++ P + V YN L+ L ++G Q+ ++LD + + G Sbjct: 296 LLAEMDKEDQPPSVVTYNILITSLSLNGRTEQAFKVLDEMTRSG 339 >ref|XP_006346048.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Solanum tuberosum] Length = 577 Score = 164 bits (414), Expect = 2e-38 Identities = 75/107 (70%), Positives = 93/107 (86%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KPD ATQLLYDLC +K+RKA RVMEMMV SGT P+ AS TFLVN+LC+RGNVG+AMQ Sbjct: 102 KPDKTHATQLLYDLCNCNKLRKAARVMEMMVSSGTIPDAASYTFLVNNLCKRGNVGHAMQ 161 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LV+++E+YGYPTNTV YNSL+RGLCM GNL +SLQ +++L+QKG++P Sbjct: 162 LVDKMEEYGYPTNTVTYNSLIRGLCMRGNLNKSLQFVEKLIQKGLVP 208 >ref|XP_004243988.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Solanum lycopersicum] Length = 577 Score = 164 bits (414), Expect = 2e-38 Identities = 75/107 (70%), Positives = 93/107 (86%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KPD ATQLLYDLC +K+RKA RVMEMMV SGT P+ AS TFLVN+LC+RGNVG+AMQ Sbjct: 102 KPDKTHATQLLYDLCNCNKLRKAARVMEMMVSSGTIPDAASYTFLVNNLCKRGNVGHAMQ 161 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LV+++E+YGYPTNTV YNSL+RGLCM GNL +SLQ +++L+QKG++P Sbjct: 162 LVDKMEEYGYPTNTVTYNSLIRGLCMRGNLNKSLQFVEKLIQKGLVP 208 >ref|XP_003531505.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like isoform X1 [Glycine max] Length = 572 Score = 164 bits (414), Expect = 2e-38 Identities = 79/107 (73%), Positives = 92/107 (85%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KP+V QATQLLYDLCK +K RKA RVMEMMV SG P+ AS T LVN LC+RGNVGYA+Q Sbjct: 96 KPEVNQATQLLYDLCKFNKARKAVRVMEMMVGSGIIPDAASYTHLVNFLCKRGNVGYAIQ 155 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LVE++E +G+PTNTV YN+LV+GLCMHGNL QSLQLLDRL +KG+IP Sbjct: 156 LVEKMEGHGFPTNTVTYNTLVKGLCMHGNLNQSLQLLDRLTKKGLIP 202 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/104 (25%), Positives = 52/104 (50%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 +P++ LL LCK + +A ++ + + G +P + S L+ LC G A + Sbjct: 236 EPNLVSYNVLLTGLCKEGRTEEAIKLFQELPVKGFSPSVVSFNILLRSLCYEGRWEEANE 295 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKG 11 L+ ++ P + V YN L+ L ++G Q+ ++LD + + G Sbjct: 296 LLAEMDKEDQPPSVVTYNILITSLSLNGRTEQAFKVLDEMTRSG 339 >ref|XP_006598186.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Glycine max] Length = 571 Score = 163 bits (413), Expect = 2e-38 Identities = 78/107 (72%), Positives = 92/107 (85%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 KP+V QATQLLYDLCK +K RKA RVMEMMV SG P+ AS T LVN LC+RGNVGYA+Q Sbjct: 96 KPEVNQATQLLYDLCKFNKARKAVRVMEMMVGSGIIPDAASYTHLVNFLCKRGNVGYAIQ 155 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 LVE++E +G+PTNTV YN+LV+GLCMHGNL QSLQLLDRL +KG++P Sbjct: 156 LVEKMEGHGFPTNTVTYNTLVKGLCMHGNLNQSLQLLDRLTKKGLVP 202 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/104 (26%), Positives = 51/104 (49%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 +P++ LL LCK + +A ++ + G +P + S L+ LC G A + Sbjct: 236 EPNLVSYNVLLTGLCKEGRTEEAIKLFRELPAKGFSPSVVSFNILLRSLCYEGRWEEANE 295 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKG 11 L+ ++ P + V YN L+ L +HG Q+ ++LD + + G Sbjct: 296 LLAEMDKEDQPPSVVTYNILITSLSLHGRTEQAFKVLDEMTRSG 339 >ref|XP_006836423.1| hypothetical protein AMTR_s00092p00157010 [Amborella trichopoda] gi|548838941|gb|ERM99276.1| hypothetical protein AMTR_s00092p00157010 [Amborella trichopoda] Length = 486 Score = 163 bits (413), Expect = 2e-38 Identities = 74/108 (68%), Positives = 95/108 (87%) Frame = -2 Query: 325 HKPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAM 146 H+PD+ Q+TQLLYDLCKS+K+RKA RVME++V SG P++A+ T+LVN LC++GN+GYAM Sbjct: 16 HRPDMAQSTQLLYDLCKSNKIRKAVRVMEIIVGSGQVPDIATYTYLVNQLCKKGNIGYAM 75 Query: 145 QLVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 QLVE+++ YG P NTV YNSLVRGLC+HGNL QSLQLL++LMQKG+ P Sbjct: 76 QLVEKMDQYGLPPNTVTYNSLVRGLCIHGNLQQSLQLLEKLMQKGLTP 123 >ref|XP_004488838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cicer arietinum] Length = 572 Score = 163 bits (412), Expect = 3e-38 Identities = 76/108 (70%), Positives = 93/108 (86%) Frame = -2 Query: 325 HKPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAM 146 HKPDV QATQLLYDLCKS K RKA RVME+M SG P++AS TFLVN+LC+RGNVGYAM Sbjct: 98 HKPDVVQATQLLYDLCKSGKARKAVRVMEIMGGSGIIPDVASYTFLVNYLCKRGNVGYAM 157 Query: 145 QLVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKGMIP 2 QLVE++E G+PTNTV YN+LV+GLC HG L QS+Q+LD+L++KG++P Sbjct: 158 QLVEKMEGLGFPTNTVTYNTLVKGLCTHGKLNQSMQILDKLIKKGLVP 205 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/104 (26%), Positives = 51/104 (49%) Frame = -2 Query: 322 KPDVRQATQLLYDLCKSSKMRKATRVMEMMVCSGTNPELASCTFLVNHLCRRGNVGYAMQ 143 +P++ LL LCK + +A + + G P + S L+ LC G A + Sbjct: 239 EPNLVSYNVLLTGLCKEGRTEEAIELFRELPAKGFKPCVVSHNILLRSLCYDGRWEEAYK 298 Query: 142 LVERLEDYGYPTNTVIYNSLVRGLCMHGNLTQSLQLLDRLMQKG 11 L+ +++ G + V YN L+ L +HG + Q+ ++LD + + G Sbjct: 299 LLAEMDEEGQAPSVVTYNILITSLSLHGRIEQAFKVLDEMARSG 342