BLASTX nr result
ID: Paeonia24_contig00035948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00035948 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, part... 75 9e-12 ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 75 9e-12 ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prun... 75 9e-12 ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, part... 75 9e-12 ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, part... 74 2e-11 >ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] gi|462423886|gb|EMJ28149.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] Length = 1347 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = -3 Query: 182 LSKINLPNLKLSDRALTQWKSHTKY*IIDSIESLTWKEFKRHLRKQFYPVGYKEERWYKW 3 + KI +LKLS ALT WKS+ + + LTWK FK+ LRKQFYPVGY++ERWYKW Sbjct: 79 VQKIKFASLKLSSHALTWWKSYQRR---YDVSELTWKNFKKLLRKQFYPVGYEDERWYKW 135 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = -3 Query: 182 LSKINLPNLKLSDRALTQWKSHTKY*IIDSIESLTWKEFKRHLRKQFYPVGYKEERWYKW 3 + KI +LKLS ALT WKS+ + + LTWK FK+ LRKQFYPVGY++ERWYKW Sbjct: 150 VQKIKFASLKLSSHALTWWKSYQRR---YDVSELTWKNFKKLLRKQFYPVGYEDERWYKW 206 >ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] gi|462415599|gb|EMJ20336.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] Length = 1484 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = -3 Query: 182 LSKINLPNLKLSDRALTQWKSHTKY*IIDSIESLTWKEFKRHLRKQFYPVGYKEERWYKW 3 + KI +LKLS ALT WKS+ + + LTWK FK+ LRKQFYPVGY++ERWYKW Sbjct: 160 VQKIKFASLKLSSHALTWWKSYQRR---YDVSELTWKNFKKLLRKQFYPVGYEDERWYKW 216 >ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] gi|462398849|gb|EMJ04517.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] Length = 1488 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = -3 Query: 182 LSKINLPNLKLSDRALTQWKSHTKY*IIDSIESLTWKEFKRHLRKQFYPVGYKEERWYKW 3 + KI +LKLS ALT WKS+ + + LTWK FK+ LRKQFYPVGY++ERWYKW Sbjct: 150 VQKIKFASLKLSSHALTWWKSYQRR---YDVSELTWKNFKKLLRKQFYPVGYEDERWYKW 206 >ref|XP_007220363.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] gi|462416825|gb|EMJ21562.1| hypothetical protein PRUPE_ppa016496mg, partial [Prunus persica] Length = 373 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/60 (55%), Positives = 42/60 (70%) Frame = -3 Query: 182 LSKINLPNLKLSDRALTQWKSHTKY*IIDSIESLTWKEFKRHLRKQFYPVGYKEERWYKW 3 + KI ++KLS ALT WKS+ + + LTWK FK+ LRKQFYPVGY++ERWYKW Sbjct: 38 VQKIKFASMKLSSHALTWWKSYQRR---YDVSELTWKNFKKLLRKQFYPVGYEDERWYKW 94