BLASTX nr result
ID: Paeonia24_contig00035909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00035909 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006601432.1| PREDICTED: putative pentatricopeptide repeat... 104 1e-20 ref|XP_007155315.1| hypothetical protein PHAVU_003G190600g [Phas... 103 2e-20 ref|XP_003609069.1| Pentatricopeptide repeat protein [Medicago t... 102 7e-20 ref|XP_007211285.1| hypothetical protein PRUPE_ppa002699mg [Prun... 100 2e-19 ref|XP_004301149.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_004137583.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 ref|XP_002282084.1| PREDICTED: pentatricopeptide repeat-containi... 96 5e-18 ref|XP_006362625.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 96 7e-18 ref|XP_007037335.1| Tetratricopeptide repeat (TPR)-like superfam... 95 9e-18 ref|XP_006425654.1| hypothetical protein CICLE_v10025166mg [Citr... 95 1e-17 gb|EMT14400.1| hypothetical protein F775_09464 [Aegilops tauschii] 93 4e-17 gb|EMS45498.1| hypothetical protein TRIUR3_12201 [Triticum urartu] 93 4e-17 ref|XP_002868248.1| pentatricopeptide repeat-containing protein ... 93 4e-17 ref|XP_006283207.1| hypothetical protein CARUB_v10004238mg [Caps... 92 6e-17 ref|XP_007034786.1| Pentatricopeptide repeat (PPR) superfamily p... 92 7e-17 ref|XP_006301886.1| hypothetical protein CARUB_v10022358mg [Caps... 92 7e-17 ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containi... 92 7e-17 ref|XP_003557645.1| PREDICTED: pentatricopeptide repeat-containi... 92 7e-17 gb|EYU24377.1| hypothetical protein MIMGU_mgv1a020160mg [Mimulus... 92 1e-16 ref|XP_004485987.1| PREDICTED: pentatricopeptide repeat-containi... 92 1e-16 >ref|XP_006601432.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g74580-like [Glycine max] Length = 1428 Score = 104 bits (260), Expect = 1e-20 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = -3 Query: 402 RTLRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 R LRIVKNLRVCGDCHTVMKLISKVY++EI+VRDRSRFHSFKDG C+C+DYW Sbjct: 1377 RILRIVKNLRVCGDCHTVMKLISKVYQVEIIVRDRSRFHSFKDGFCSCRDYW 1428 >ref|XP_007155315.1| hypothetical protein PHAVU_003G190600g [Phaseolus vulgaris] gi|561028669|gb|ESW27309.1| hypothetical protein PHAVU_003G190600g [Phaseolus vulgaris] Length = 626 Score = 103 bits (257), Expect = 2e-20 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = -3 Query: 402 RTLRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 R LRIVKNLRVCGDCHTVMKLISK+Y +EI+VRDRSRFHSFKDG C+C+DYW Sbjct: 575 RILRIVKNLRVCGDCHTVMKLISKIYRVEIIVRDRSRFHSFKDGFCSCRDYW 626 >ref|XP_003609069.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355510124|gb|AES91266.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 611 Score = 102 bits (253), Expect = 7e-20 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = -3 Query: 402 RTLRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 R LRIVKNLRVCGDCHTVMKLISKVY++EI+VRDRSRFHSFK G C+C+DYW Sbjct: 560 RILRIVKNLRVCGDCHTVMKLISKVYQVEIIVRDRSRFHSFKGGFCSCRDYW 611 >ref|XP_007211285.1| hypothetical protein PRUPE_ppa002699mg [Prunus persica] gi|462407020|gb|EMJ12484.1| hypothetical protein PRUPE_ppa002699mg [Prunus persica] Length = 643 Score = 100 bits (249), Expect = 2e-19 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -3 Query: 396 LRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 +RIVKNLRVC DCHTVMKLISKVY LEIVVRDRSRFHSFKDG C+CKDYW Sbjct: 594 IRIVKNLRVCRDCHTVMKLISKVYRLEIVVRDRSRFHSFKDGSCSCKDYW 643 >ref|XP_004301149.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Fragaria vesca subsp. vesca] Length = 643 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/52 (84%), Positives = 46/52 (88%) Frame = -3 Query: 402 RTLRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 R +RIVKNLRVC DCHTVMKLISKVY EIVVRDRSRFHSFKDG C+C DYW Sbjct: 592 RMIRIVKNLRVCRDCHTVMKLISKVYRSEIVVRDRSRFHSFKDGSCSCNDYW 643 >ref|XP_004137583.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Cucumis sativus] gi|449487109|ref|XP_004157499.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Cucumis sativus] Length = 642 Score = 96.3 bits (238), Expect = 4e-18 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = -3 Query: 402 RTLRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 R +R+VKNLR+C DCHTVMKLISKVYE+EIVVRDRSRFHSF G C+C+DYW Sbjct: 591 RAIRVVKNLRICRDCHTVMKLISKVYEVEIVVRDRSRFHSFTHGSCSCRDYW 642 >ref|XP_002282084.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74630-like [Vitis vinifera] Length = 643 Score = 95.9 bits (237), Expect = 5e-18 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = -3 Query: 396 LRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 +RIVKNLRVC DCHTVMKLISKVY LEIVVRDRSRFHSFK G C+C+DYW Sbjct: 594 IRIVKNLRVCRDCHTVMKLISKVYGLEIVVRDRSRFHSFKTGSCSCRDYW 643 >ref|XP_006362625.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g74630-like [Solanum tuberosum] Length = 526 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -3 Query: 399 TLRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 T+RIVKNLRVC DCH+ MKLISKVY LEIVVRDRSRFHSFK+G C+C+DYW Sbjct: 476 TIRIVKNLRVCKDCHSFMKLISKVYGLEIVVRDRSRFHSFKEGSCSCRDYW 526 >ref|XP_007037335.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508774580|gb|EOY21836.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 643 Score = 95.1 bits (235), Expect = 9e-18 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = -3 Query: 402 RTLRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 R +RIVKNLR+C DCHTVMKLISKVY L++VVRDRSRFH F DG C+CKDYW Sbjct: 592 RDIRIVKNLRICRDCHTVMKLISKVYGLKVVVRDRSRFHMFNDGSCSCKDYW 643 >ref|XP_006425654.1| hypothetical protein CICLE_v10025166mg [Citrus clementina] gi|568824869|ref|XP_006466814.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] gi|557527644|gb|ESR38894.1| hypothetical protein CICLE_v10025166mg [Citrus clementina] Length = 622 Score = 94.7 bits (234), Expect = 1e-17 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -3 Query: 399 TLRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 T+RI+KNLRVC DCHTVMKLISK+Y+ EIV+RDR+RFH FKDG CTC DYW Sbjct: 572 TIRIIKNLRVCEDCHTVMKLISKIYDREIVMRDRTRFHHFKDGRCTCGDYW 622 >gb|EMT14400.1| hypothetical protein F775_09464 [Aegilops tauschii] Length = 596 Score = 92.8 bits (229), Expect = 4e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -3 Query: 396 LRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 +RIVKNLRVCGDCH V+KLISKVY+ EI+VRDRSRFH FK G C+CKDYW Sbjct: 547 IRIVKNLRVCGDCHLVIKLISKVYDREIIVRDRSRFHHFKGGECSCKDYW 596 >gb|EMS45498.1| hypothetical protein TRIUR3_12201 [Triticum urartu] Length = 402 Score = 92.8 bits (229), Expect = 4e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -3 Query: 396 LRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 +RIVKNLRVCGDCH V+KLISKVY+ EI+VRDRSRFH FK G C+CKDYW Sbjct: 353 IRIVKNLRVCGDCHLVIKLISKVYDREIIVRDRSRFHHFKGGECSCKDYW 402 >ref|XP_002868248.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297314084|gb|EFH44507.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 725 Score = 92.8 bits (229), Expect = 4e-17 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -3 Query: 396 LRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 +RIVKNLRVC DCH KL+SKVYELEI+VRDR+RFH +KDGLC+C+DYW Sbjct: 676 IRIVKNLRVCEDCHAFFKLVSKVYELEIIVRDRTRFHRYKDGLCSCRDYW 725 >ref|XP_006283207.1| hypothetical protein CARUB_v10004238mg [Capsella rubella] gi|482551912|gb|EOA16105.1| hypothetical protein CARUB_v10004238mg [Capsella rubella] Length = 724 Score = 92.4 bits (228), Expect = 6e-17 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -3 Query: 396 LRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 +RIVKNLRVC DCHT KL+SKVYE EI+VRDR+RFH +KDGLC+C+DYW Sbjct: 675 IRIVKNLRVCEDCHTFFKLVSKVYEREIIVRDRTRFHHYKDGLCSCRDYW 724 >ref|XP_007034786.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508713815|gb|EOY05712.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 722 Score = 92.0 bits (227), Expect = 7e-17 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -3 Query: 396 LRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 +RIVKNLRVC DCHT MKL+SK+Y EIVVRDR+RFH +KDGLC+CKDYW Sbjct: 673 IRIVKNLRVCEDCHTFMKLVSKLYGREIVVRDRTRFHHYKDGLCSCKDYW 722 >ref|XP_006301886.1| hypothetical protein CARUB_v10022358mg [Capsella rubella] gi|482570596|gb|EOA34784.1| hypothetical protein CARUB_v10022358mg [Capsella rubella] Length = 643 Score = 92.0 bits (227), Expect = 7e-17 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -3 Query: 396 LRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 +RIVKNLR+C DCH VMKL SKVY +EIVVRDR+RFHSFKDG C+C+DYW Sbjct: 594 IRIVKNLRICRDCHAVMKLTSKVYGVEIVVRDRNRFHSFKDGSCSCRDYW 643 >ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 659 Score = 92.0 bits (227), Expect = 7e-17 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -3 Query: 399 TLRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 T+R+VKNLRVC DCHT KLISKVY EI+VRDR+RFH FKDG C+CKD+W Sbjct: 609 TIRVVKNLRVCSDCHTATKLISKVYNREIIVRDRNRFHQFKDGSCSCKDFW 659 >ref|XP_003557645.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Brachypodium distachyon] Length = 598 Score = 92.0 bits (227), Expect = 7e-17 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -3 Query: 396 LRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 +RIVKNLRVCGDCH +KLISKVY+ EI+VRDRSRFH FK G C+CKDYW Sbjct: 549 IRIVKNLRVCGDCHMAIKLISKVYDREIIVRDRSRFHHFKGGACSCKDYW 598 >gb|EYU24377.1| hypothetical protein MIMGU_mgv1a020160mg [Mimulus guttatus] Length = 580 Score = 91.7 bits (226), Expect = 1e-16 Identities = 39/52 (75%), Positives = 47/52 (90%) Frame = -3 Query: 402 RTLRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 + +R+VKNLRVC DCH VMKLIS+VY LEI++RDRSRFHSFK+G C+CKDYW Sbjct: 529 KIVRVVKNLRVCKDCHNVMKLISEVYGLEILLRDRSRFHSFKNGSCSCKDYW 580 >ref|XP_004485987.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 610 Score = 91.7 bits (226), Expect = 1e-16 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = -3 Query: 396 LRIVKNLRVCGDCHTVMKLISKVYELEIVVRDRSRFHSFKDGLCTCKDYW 247 +R++KNLRVC DCH +KLISKVY+ EIV+RDRSRFH F+DGLC+CKDYW Sbjct: 561 IRVMKNLRVCADCHMAIKLISKVYDREIVIRDRSRFHHFRDGLCSCKDYW 610