BLASTX nr result
ID: Paeonia24_contig00035727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00035727 (215 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004490637.1| PREDICTED: serine carboxypeptidase-like 42-l... 56 1e-06 >ref|XP_004490637.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Cicer arietinum] Length = 509 Score = 56.2 bits (134), Expect(2) = 1e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 109 ISKLIQATKISVGFDVCMTYEKRLYFNLSEVQKAL 213 + L+QATKIS+G DVCM+YE+R YFNL EVQKAL Sbjct: 334 VISLMQATKISIGVDVCMSYERRFYFNLPEVQKAL 368 Score = 21.6 bits (44), Expect(2) = 1e-06 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 3 LVEQELRL*KMV 38 +VEQELRL KMV Sbjct: 296 IVEQELRLKKMV 307