BLASTX nr result
ID: Paeonia24_contig00035129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00035129 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522899.1| transcriptional adaptor, putative [Ricinus c... 61 1e-07 ref|XP_006380904.1| hypothetical protein POPTR_0006s01830g [Popu... 60 2e-07 ref|XP_002307906.2| hypothetical protein POPTR_0006s01830g [Popu... 60 2e-07 ref|XP_002323129.1| hypothetical protein POPTR_0016s00940g [Popu... 59 5e-07 gb|EXB29530.1| Transcriptional adapter ADA2b [Morus notabilis] 57 2e-06 ref|XP_007026320.1| Histone acetyltransferase complex component ... 55 8e-06 >ref|XP_002522899.1| transcriptional adaptor, putative [Ricinus communis] gi|223537884|gb|EEF39499.1| transcriptional adaptor, putative [Ricinus communis] Length = 541 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -2 Query: 280 FKGNVTKKSDAHPLFNFHFSQIDRIYDVLVKKGIAKP 170 F GNVTKK+DAHPLF S++DR+YDVLVKKGIA+P Sbjct: 505 FIGNVTKKADAHPLFKLEASKVDRVYDVLVKKGIAQP 541 >ref|XP_006380904.1| hypothetical protein POPTR_0006s01830g [Populus trichocarpa] gi|550335248|gb|ERP58701.1| hypothetical protein POPTR_0006s01830g [Populus trichocarpa] Length = 494 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -2 Query: 280 FKGNVTKKSDAHPLFNFHFSQIDRIYDVLVKKGIAKP 170 F GN+TKK DAHPLF S++DR+YD+LVKKGIA+P Sbjct: 458 FSGNITKKLDAHPLFKIEASKVDRVYDILVKKGIAQP 494 >ref|XP_002307906.2| hypothetical protein POPTR_0006s01830g [Populus trichocarpa] gi|550335247|gb|EEE91429.2| hypothetical protein POPTR_0006s01830g [Populus trichocarpa] Length = 430 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -2 Query: 280 FKGNVTKKSDAHPLFNFHFSQIDRIYDVLVKKGIAKP 170 F GN+TKK DAHPLF S++DR+YD+LVKKGIA+P Sbjct: 394 FSGNITKKLDAHPLFKIEASKVDRVYDILVKKGIAQP 430 >ref|XP_002323129.1| hypothetical protein POPTR_0016s00940g [Populus trichocarpa] gi|222867759|gb|EEF04890.1| hypothetical protein POPTR_0016s00940g [Populus trichocarpa] Length = 505 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -2 Query: 280 FKGNVTKKSDAHPLFNFHFSQIDRIYDVLVKKGIAKP 170 F GN+TKKSDAHPLF S++D +YD+LVKKGIA+P Sbjct: 469 FSGNITKKSDAHPLFKIEASKVDGVYDMLVKKGIAQP 505 >gb|EXB29530.1| Transcriptional adapter ADA2b [Morus notabilis] Length = 553 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -2 Query: 280 FKGNVTKKSDAHPLFNFHFSQIDRIYDVLVKKGIAKP 170 F GN+TKKSDAH LF S+IDR+YD+LVKKGIA+P Sbjct: 517 FSGNMTKKSDAHHLFKIEPSKIDRVYDMLVKKGIAQP 553 >ref|XP_007026320.1| Histone acetyltransferase complex component isoform 1 [Theobroma cacao] gi|508781686|gb|EOY28942.1| Histone acetyltransferase complex component isoform 1 [Theobroma cacao] Length = 550 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -2 Query: 280 FKGNVTKKSDAHPLFNFHFSQIDRIYDVLVKKGIAKP 170 F GNVTKKSDAH LF S+ DR+YD+LVKKGIA P Sbjct: 514 FSGNVTKKSDAHRLFKLDPSKTDRVYDMLVKKGIAPP 550