BLASTX nr result
ID: Paeonia24_contig00035075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00035075 (484 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150126.1| PREDICTED: uncharacterized protein LOC101221... 57 3e-06 >ref|XP_004150126.1| PREDICTED: uncharacterized protein LOC101221019 [Cucumis sativus] Length = 390 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/57 (50%), Positives = 35/57 (61%), Gaps = 3/57 (5%) Frame = -3 Query: 482 HPSPYTI-WLKNGSEACVYRCL*V*L--GKSYFDTVACDVVNMDVCHAFLGRPS*YE 321 HP+PY I W+K G EA V V L G +Y D + CDV+ MDVCH LGRP Y+ Sbjct: 83 HPTPYKIGWVKKGGEATVSEICTVPLSIGNAYKDQIVCDVIEMDVCHLLLGRPWQYD 139