BLASTX nr result
ID: Paeonia24_contig00034920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00034920 (221 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006451131.1| hypothetical protein CICLE_v10009547mg [Citr... 63 4e-08 ref|XP_007013197.1| Ras-related small GTP-binding family protein... 63 4e-08 ref|XP_004287100.1| PREDICTED: ras-related protein RHN1-like [Fr... 63 4e-08 ref|XP_007202363.1| hypothetical protein PRUPE_ppa009206mg [Prun... 63 4e-08 emb|CBK22206.2| unnamed protein product [Blastocystis hominis] 63 4e-08 ref|XP_002514320.1| protein with unknown function [Ricinus commu... 63 4e-08 ref|XP_002284542.1| PREDICTED: ras-related protein RHN1 isoform ... 63 4e-08 gb|EXB37023.1| Ras-related protein Rab5 [Morus notabilis] 63 5e-08 ref|XP_006584840.1| PREDICTED: ras-related protein RHN1-like iso... 63 5e-08 ref|XP_006584839.1| PREDICTED: ras-related protein RHN1-like iso... 63 5e-08 ref|XP_006584838.1| PREDICTED: ras-related protein RHN1-like iso... 63 5e-08 ref|XP_006580464.1| PREDICTED: ras-related protein RHN1-like iso... 63 5e-08 gb|ETO31302.1| ras-related protein Rab-5B [Reticulomyxa filosa] 63 5e-08 ref|XP_007160341.1| hypothetical protein PHAVU_002G313600g [Phas... 63 5e-08 ref|XP_006830139.1| hypothetical protein AMTR_s00200p00019350 [A... 63 5e-08 ref|XP_003524390.1| PREDICTED: ras-related protein RHN1-like iso... 63 5e-08 ref|XP_003630800.1| Ras-related protein Rab-5C [Medicago truncat... 63 5e-08 gb|ESO06239.1| hypothetical protein HELRODRAFT_155684 [Helobdell... 62 6e-08 gb|ESN98859.1| hypothetical protein HELRODRAFT_107032 [Helobdell... 62 6e-08 ref|NP_001133617.1| Ras-related protein Rab-5A [Salmo salar] gi|... 62 8e-08 >ref|XP_006451131.1| hypothetical protein CICLE_v10009547mg [Citrus clementina] gi|567918252|ref|XP_006451132.1| hypothetical protein CICLE_v10009547mg [Citrus clementina] gi|568843412|ref|XP_006475604.1| PREDICTED: ras-related protein RHN1-like [Citrus sinensis] gi|557554357|gb|ESR64371.1| hypothetical protein CICLE_v10009547mg [Citrus clementina] gi|557554358|gb|ESR64372.1| hypothetical protein CICLE_v10009547mg [Citrus clementina] Length = 199 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 TIKFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 58 TIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITS 94 >ref|XP_007013197.1| Ras-related small GTP-binding family protein [Theobroma cacao] gi|508783560|gb|EOY30816.1| Ras-related small GTP-binding family protein [Theobroma cacao] Length = 261 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 TIKFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 120 TIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITS 156 >ref|XP_004287100.1| PREDICTED: ras-related protein RHN1-like [Fragaria vesca subsp. vesca] Length = 198 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 TIKFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 58 TIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITS 94 >ref|XP_007202363.1| hypothetical protein PRUPE_ppa009206mg [Prunus persica] gi|462397894|gb|EMJ03562.1| hypothetical protein PRUPE_ppa009206mg [Prunus persica] Length = 302 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 TIKFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 161 TIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITS 197 >emb|CBK22206.2| unnamed protein product [Blastocystis hominis] Length = 364 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 217 IKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTSKIT 101 +KFDIWDTAGQERY+SLAPMYYRG +YD+TS+ T Sbjct: 63 VKFDIWDTAGQERYHSLAPMYYRGAKGALVIYDITSRTT 101 >ref|XP_002514320.1| protein with unknown function [Ricinus communis] gi|223546776|gb|EEF48274.1| protein with unknown function [Ricinus communis] Length = 199 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 TIKFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 58 TIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITS 94 >ref|XP_002284542.1| PREDICTED: ras-related protein RHN1 isoform 1 [Vitis vinifera] gi|359484588|ref|XP_003633124.1| PREDICTED: ras-related protein RHN1 isoform 2 [Vitis vinifera] gi|297738837|emb|CBI28082.3| unnamed protein product [Vitis vinifera] Length = 200 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 TIKFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 58 TIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITS 94 >gb|EXB37023.1| Ras-related protein Rab5 [Morus notabilis] Length = 182 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 TIKFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 40 TIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDVTS 76 >ref|XP_006584840.1| PREDICTED: ras-related protein RHN1-like isoform X3 [Glycine max] Length = 161 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 T+KFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 40 TVKFDIWDTAGQERYHSLAPMYYRGAAAAIVVYDITS 76 >ref|XP_006584839.1| PREDICTED: ras-related protein RHN1-like isoform X2 [Glycine max] Length = 179 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 T+KFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 58 TVKFDIWDTAGQERYHSLAPMYYRGAAAAIVVYDITS 94 >ref|XP_006584838.1| PREDICTED: ras-related protein RHN1-like isoform X1 [Glycine max] Length = 200 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 T+KFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 79 TVKFDIWDTAGQERYHSLAPMYYRGAAAAIVVYDITS 115 >ref|XP_006580464.1| PREDICTED: ras-related protein RHN1-like isoform X2 [Glycine max] Length = 181 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 T+KFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 40 TVKFDIWDTAGQERYHSLAPMYYRGAAAAIVVYDITS 76 >gb|ETO31302.1| ras-related protein Rab-5B [Reticulomyxa filosa] Length = 187 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTSKI 104 T+KF+IWDTAGQERY+SLAPMYYRG VYD+TS++ Sbjct: 100 TVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDITSQV 138 >ref|XP_007160341.1| hypothetical protein PHAVU_002G313600g [Phaseolus vulgaris] gi|561033756|gb|ESW32335.1| hypothetical protein PHAVU_002G313600g [Phaseolus vulgaris] Length = 200 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 T+KFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 59 TVKFDIWDTAGQERYHSLAPMYYRGAAAAIVVYDITS 95 >ref|XP_006830139.1| hypothetical protein AMTR_s00200p00019350 [Amborella trichopoda] gi|548836188|gb|ERM97555.1| hypothetical protein AMTR_s00200p00019350 [Amborella trichopoda] Length = 200 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 T+KFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 58 TVKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITS 94 >ref|XP_003524390.1| PREDICTED: ras-related protein RHN1-like isoform X1 [Glycine max] Length = 199 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 T+KFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 58 TVKFDIWDTAGQERYHSLAPMYYRGAAAAIVVYDITS 94 >ref|XP_003630800.1| Ras-related protein Rab-5C [Medicago truncatula] gi|355524822|gb|AET05276.1| Ras-related protein Rab-5C [Medicago truncatula] Length = 190 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTS 110 T+KFDIWDTAGQERY+SLAPMYYRG VYD+TS Sbjct: 49 TVKFDIWDTAGQERYHSLAPMYYRGSAAAIVVYDITS 85 >gb|ESO06239.1| hypothetical protein HELRODRAFT_155684 [Helobdella robusta] Length = 202 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTSKIT 101 T+KF+IWDTAGQERY+SLAPMYYRG VYD+TS+ T Sbjct: 59 TVKFEIWDTAGQERYHSLAPMYYRGAQAAIIVYDITSQDT 98 >gb|ESN98859.1| hypothetical protein HELRODRAFT_107032 [Helobdella robusta] Length = 210 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTSKIT 101 T+KF+IWDTAGQERY+SLAPMYYRG VYD+TS+ T Sbjct: 64 TVKFEIWDTAGQERYHSLAPMYYRGAHVAIVVYDITSQDT 103 >ref|NP_001133617.1| Ras-related protein Rab-5A [Salmo salar] gi|197631797|gb|ACH70622.1| member RAS oncogene family [Salmo salar] gi|209154698|gb|ACI33581.1| Ras-related protein Rab-5A [Salmo salar] Length = 216 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -2 Query: 220 TIKFDIWDTAGQERYYSLAPMYYRGXXXXXXVYDLTSK 107 T+KF+IWDTAGQERY+SLAPMYYRG VYD+T+K Sbjct: 69 TVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNK 106