BLASTX nr result
ID: Paeonia24_contig00034194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00034194 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB65587.1| hypothetical protein L484_025853 [Morus notabilis] 117 1e-24 emb|CBI26947.3| unnamed protein product [Vitis vinifera] 117 2e-24 ref|XP_002280156.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 emb|CAN69810.1| hypothetical protein VITISV_043106 [Vitis vinifera] 117 2e-24 ref|XP_006468786.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 ref|XP_006448333.1| hypothetical protein CICLE_v10017504mg, part... 102 4e-20 gb|EPS62023.1| hypothetical protein M569_12769, partial [Genlise... 98 1e-18 ref|XP_006416136.1| hypothetical protein EUTSA_v10006897mg [Eutr... 97 2e-18 ref|XP_002893253.1| hypothetical protein ARALYDRAFT_313173 [Arab... 97 3e-18 ref|XP_006344193.1| PREDICTED: pentatricopeptide repeat-containi... 93 3e-17 ref|XP_004498286.1| PREDICTED: pentatricopeptide repeat-containi... 93 4e-17 ref|XP_006303768.1| hypothetical protein CARUB_v10011979mg [Caps... 93 4e-17 ref|XP_007153363.1| hypothetical protein PHAVU_003G029100g [Phas... 92 6e-17 gb|AAB72163.1| hypothetical protein [Arabidopsis thaliana] 91 2e-16 ref|NP_173709.1| pentatricopeptide repeat-containing protein [Ar... 91 2e-16 ref|XP_006596228.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_004300944.1| PREDICTED: pentatricopeptide repeat-containi... 86 5e-15 ref|XP_003543970.1| PREDICTED: pentatricopeptide repeat-containi... 86 5e-15 ref|XP_003589662.1| Pentatricopeptide repeat-containing protein ... 84 2e-14 ref|XP_006846521.1| hypothetical protein AMTR_s00018p00185360 [A... 83 5e-14 >gb|EXB65587.1| hypothetical protein L484_025853 [Morus notabilis] Length = 742 Score = 117 bits (294), Expect = 1e-24 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 1/90 (1%) Frame = -2 Query: 267 CALLEVLVQNNIMSSAYSVTERAISLH-MYGIVDVLINEYSSSEVWVKLLEFVLWVYTKK 91 CA+LE+LV NN+M SA+ V ERAI ++ M+GIVDVLI Y +V +K+L+ VLW YTK+ Sbjct: 134 CAILEILVVNNLMRSAFWVAERAIVVNNMHGIVDVLIGGYVCDKVSIKILDLVLWAYTKE 193 Query: 90 MMIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 MIEQCLS DKM+ NGLLP+VKNCNRILR Sbjct: 194 SMIEQCLSVLDKMVRNGLLPDVKNCNRILR 223 >emb|CBI26947.3| unnamed protein product [Vitis vinifera] Length = 1078 Score = 117 bits (292), Expect = 2e-24 Identities = 57/89 (64%), Positives = 71/89 (79%) Frame = -2 Query: 267 CALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKM 88 CA+LE+L QNN+M SAY V ER I+ +M+ IVDVLI SSEV VK+L+ ++WVY+KK Sbjct: 119 CAILEILAQNNLMRSAYWVMERVINANMHRIVDVLIGGCVSSEVSVKILDLLIWVYSKKS 178 Query: 87 MIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 M+EQCLS FDKMI + L P+VKNCNRILR Sbjct: 179 MVEQCLSVFDKMIKSRLSPDVKNCNRILR 207 >ref|XP_002280156.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Vitis vinifera] Length = 718 Score = 117 bits (292), Expect = 2e-24 Identities = 57/89 (64%), Positives = 71/89 (79%) Frame = -2 Query: 267 CALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKM 88 CA+LE+L QNN+M SAY V ER I+ +M+ IVDVLI SSEV VK+L+ ++WVY+KK Sbjct: 119 CAILEILAQNNLMRSAYWVMERVINANMHRIVDVLIGGCVSSEVSVKILDLLIWVYSKKS 178 Query: 87 MIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 M+EQCLS FDKMI + L P+VKNCNRILR Sbjct: 179 MVEQCLSVFDKMIKSRLSPDVKNCNRILR 207 >emb|CAN69810.1| hypothetical protein VITISV_043106 [Vitis vinifera] Length = 847 Score = 117 bits (292), Expect = 2e-24 Identities = 57/89 (64%), Positives = 71/89 (79%) Frame = -2 Query: 267 CALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKM 88 CA+LE+L QNN+M SAY V ER I+ +M+ IVDVLI SSEV VK+L+ ++WVY+KK Sbjct: 425 CAILEILAQNNLMRSAYWVMERVINANMHRIVDVLIGGCVSSEVSVKILDLLIWVYSKKS 484 Query: 87 MIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 M+EQCLS FDKMI + L P+VKNCNRILR Sbjct: 485 MVEQCLSVFDKMIKSRLSPDVKNCNRILR 513 >ref|XP_006468786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Citrus sinensis] Length = 729 Score = 102 bits (255), Expect = 4e-20 Identities = 46/89 (51%), Positives = 69/89 (77%) Frame = -2 Query: 267 CALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKM 88 C +LE+L+++ ++ SAY V E + ++M+GI+DVLI SS V +K+L+ +L +YTKK Sbjct: 128 CTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKS 187 Query: 87 MIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 M+EQCL F+KM+ NGLLP+VKNCNRI++ Sbjct: 188 MVEQCLLVFNKMLRNGLLPDVKNCNRIIK 216 >ref|XP_006448333.1| hypothetical protein CICLE_v10017504mg, partial [Citrus clementina] gi|557550944|gb|ESR61573.1| hypothetical protein CICLE_v10017504mg, partial [Citrus clementina] Length = 692 Score = 102 bits (255), Expect = 4e-20 Identities = 46/89 (51%), Positives = 69/89 (77%) Frame = -2 Query: 267 CALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKM 88 C +LE+L+++ ++ SAY V E + ++M+GI+DVLI SS V +K+L+ +L +YTKK Sbjct: 128 CTILEILIESGLLRSAYWVVETVVCVNMHGILDVLIGGGLSSCVSIKILDLLLLIYTKKS 187 Query: 87 MIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 M+EQCL F+KM+ NGLLP+VKNCNRI++ Sbjct: 188 MVEQCLLVFNKMLRNGLLPDVKNCNRIIK 216 >gb|EPS62023.1| hypothetical protein M569_12769, partial [Genlisea aurea] Length = 642 Score = 97.8 bits (242), Expect = 1e-18 Identities = 45/89 (50%), Positives = 63/89 (70%) Frame = -2 Query: 267 CALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKM 88 C +L +LVQN++M SAY V ER ++ M+ I+DVLI+ Y SS+ K+L +LW+YTK Sbjct: 46 CTVLGILVQNDVMRSAYWVMERVLAAKMHSILDVLIDGYLSSDTSCKVLNLLLWLYTKNS 105 Query: 87 MIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 ++C FD M+ +G LP+VKNCNRILR Sbjct: 106 EFDRCFLVFDNMVRSGHLPDVKNCNRILR 134 >ref|XP_006416136.1| hypothetical protein EUTSA_v10006897mg [Eutrema salsugineum] gi|557093907|gb|ESQ34489.1| hypothetical protein EUTSA_v10006897mg [Eutrema salsugineum] Length = 752 Score = 97.1 bits (240), Expect = 2e-18 Identities = 47/88 (53%), Positives = 63/88 (71%) Frame = -2 Query: 264 ALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKMM 85 A+LE+L +N++M+ AY V ER+I L M+GI D+LI ++ KLL+ +LWVYTKK M Sbjct: 124 AVLEILAENDLMNKAYWVAERSIDLGMHGIDDLLIEGGFDKKIAFKLLDLLLWVYTKKSM 183 Query: 84 IEQCLSTFDKMIGNGLLPEVKNCNRILR 1 EQCL +F KMI G LP V+NCN +LR Sbjct: 184 AEQCLLSFGKMIRKGFLPSVRNCNILLR 211 >ref|XP_002893253.1| hypothetical protein ARALYDRAFT_313173 [Arabidopsis lyrata subsp. lyrata] gi|297339095|gb|EFH69512.1| hypothetical protein ARALYDRAFT_313173 [Arabidopsis lyrata subsp. lyrata] Length = 1147 Score = 96.7 bits (239), Expect = 3e-18 Identities = 47/88 (53%), Positives = 65/88 (73%) Frame = -2 Query: 264 ALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKMM 85 A+LE+L +N++MS AY V ER+I+L M+ I D+LI+ V +KLL+ +LWVYTKK M Sbjct: 160 AMLEILAENDLMSEAYLVAERSINLGMHEIDDLLIDGNFDKLVALKLLDLLLWVYTKKSM 219 Query: 84 IEQCLSTFDKMIGNGLLPEVKNCNRILR 1 E+CL +F+KMI G LP V+NCN +LR Sbjct: 220 AEKCLLSFEKMIRKGFLPSVRNCNIVLR 247 >ref|XP_006344193.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565354592|ref|XP_006344194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565354594|ref|XP_006344195.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 761 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/89 (48%), Positives = 64/89 (71%) Frame = -2 Query: 267 CALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKM 88 C +L++L+QN + SAY V ER IS +M+ +VD+L++ Y + +V V++L L +YTK Sbjct: 151 CTILDILIQNGWVKSAYWVVERVISSNMHKVVDLLVDGYLNLKVSVEILNIFLRIYTKNA 210 Query: 87 MIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 +E CL F+KM+ N +LP+VKNCNRILR Sbjct: 211 NVELCLLVFEKMLRNEMLPDVKNCNRILR 239 >ref|XP_004498286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Cicer arietinum] Length = 696 Score = 92.8 bits (229), Expect = 4e-17 Identities = 47/94 (50%), Positives = 65/94 (69%), Gaps = 6/94 (6%) Frame = -2 Query: 264 ALLEVLVQNNIMSSAYSVTERAISLHMYGIV-DVLINEYSS-----SEVWVKLLEFVLWV 103 A+LE+L +N M SAY V E+ I + + +V DVL+N Y+ SEV VKLL+ +LW+ Sbjct: 92 AILEILARNGFMRSAYCVMEKVIDVKIDAVVLDVLVNNYNGGAGCGSEVSVKLLDLLLWI 151 Query: 102 YTKKMMIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 Y KK +E CL F KMI +GLLP+V+NCNR+L+ Sbjct: 152 YAKKSALENCLLIFYKMIHSGLLPDVRNCNRVLK 185 >ref|XP_006303768.1| hypothetical protein CARUB_v10011979mg [Capsella rubella] gi|482572479|gb|EOA36666.1| hypothetical protein CARUB_v10011979mg [Capsella rubella] Length = 720 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/88 (47%), Positives = 62/88 (70%) Frame = -2 Query: 264 ALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKMM 85 A+LE+L +N +M AYSV ER+I L M+ + D+LI+ + +KLL+ +LWVYT+K M Sbjct: 126 AMLEILAENGLMGEAYSVAERSIDLGMHEMDDLLIDGSFDKLIVIKLLDLLLWVYTRKYM 185 Query: 84 IEQCLSTFDKMIGNGLLPEVKNCNRILR 1 E+C +F+KMI G LP V+NCN +L+ Sbjct: 186 AEKCFLSFEKMIRKGFLPSVRNCNSVLK 213 >ref|XP_007153363.1| hypothetical protein PHAVU_003G029100g [Phaseolus vulgaris] gi|593706015|ref|XP_007153364.1| hypothetical protein PHAVU_003G029100g [Phaseolus vulgaris] gi|561026717|gb|ESW25357.1| hypothetical protein PHAVU_003G029100g [Phaseolus vulgaris] gi|561026718|gb|ESW25358.1| hypothetical protein PHAVU_003G029100g [Phaseolus vulgaris] Length = 652 Score = 92.4 bits (228), Expect = 6e-17 Identities = 45/88 (51%), Positives = 62/88 (70%), Gaps = 1/88 (1%) Frame = -2 Query: 261 LLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINE-YSSSEVWVKLLEFVLWVYTKKMM 85 +L++L +N +M SAY + E+ + G+VDVL + SSSEV VKLL+ +LW+Y KK M Sbjct: 91 ILDILARNGLMRSAYCIMEKEVVRMGGGLVDVLADGGVSSSEVCVKLLDLLLWIYAKKSM 150 Query: 84 IEQCLSTFDKMIGNGLLPEVKNCNRILR 1 + C F KM+G GLLP+VKNCNR+LR Sbjct: 151 VGMCWLVFYKMVGKGLLPDVKNCNRVLR 178 >gb|AAB72163.1| hypothetical protein [Arabidopsis thaliana] Length = 1152 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/88 (50%), Positives = 63/88 (71%) Frame = -2 Query: 264 ALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKMM 85 A+LE+L +N++MS AY V ER+I L M+ I D+LI+ + +KLL+ +LWVYTKK M Sbjct: 161 AMLEILAENDLMSEAYLVAERSIDLGMHEIDDLLIDGSFDKLIALKLLDLLLWVYTKKSM 220 Query: 84 IEQCLSTFDKMIGNGLLPEVKNCNRILR 1 E+ L +F+KMI G LP V+NCN +L+ Sbjct: 221 AEKFLLSFEKMIRKGFLPSVRNCNIVLK 248 >ref|NP_173709.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806406|sp|P0C7Q9.1|PPR56_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g22960, mitochondrial; Flags: Precursor gi|332192194|gb|AEE30315.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 718 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/88 (50%), Positives = 63/88 (71%) Frame = -2 Query: 264 ALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKMM 85 A+LE+L +N++MS AY V ER+I L M+ I D+LI+ + +KLL+ +LWVYTKK M Sbjct: 124 AMLEILAENDLMSEAYLVAERSIDLGMHEIDDLLIDGSFDKLIALKLLDLLLWVYTKKSM 183 Query: 84 IEQCLSTFDKMIGNGLLPEVKNCNRILR 1 E+ L +F+KMI G LP V+NCN +L+ Sbjct: 184 AEKFLLSFEKMIRKGFLPSVRNCNIVLK 211 >ref|XP_006596228.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X1 [Glycine max] gi|571510173|ref|XP_006596229.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X2 [Glycine max] gi|571510176|ref|XP_006596230.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X3 [Glycine max] gi|571510179|ref|XP_006596231.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X4 [Glycine max] gi|571510182|ref|XP_006596232.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X5 [Glycine max] gi|571510184|ref|XP_006596233.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X6 [Glycine max] gi|571510188|ref|XP_006596234.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X7 [Glycine max] gi|571510192|ref|XP_006596235.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X8 [Glycine max] gi|571510196|ref|XP_006596236.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X9 [Glycine max] gi|571510199|ref|XP_006596237.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X10 [Glycine max] gi|571510203|ref|XP_006596238.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X11 [Glycine max] gi|571510205|ref|XP_006596239.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X12 [Glycine max] gi|571510209|ref|XP_006596240.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X13 [Glycine max] gi|571510212|ref|XP_006596241.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X14 [Glycine max] gi|571510216|ref|XP_006596242.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X15 [Glycine max] Length = 697 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 1/88 (1%) Frame = -2 Query: 261 LLEVLVQNNIMSSAYSVTERAISLHMY-GIVDVLINEYSSSEVWVKLLEFVLWVYTKKMM 85 +L++L +N +M SAY V E+ +S+ M G+VDV+ + +S +L+ +LW+Y KK M Sbjct: 97 ILDILARNGLMRSAYCVMEKVVSVKMENGVVDVVSSSEASMSSVKLILDLLLWIYAKKSM 156 Query: 84 IEQCLSTFDKMIGNGLLPEVKNCNRILR 1 +E+CL F KM+ G+LP++KNCNR+LR Sbjct: 157 LEKCLLVFYKMVSKGMLPDLKNCNRVLR 184 >ref|XP_004300944.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 710 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/90 (46%), Positives = 62/90 (68%), Gaps = 1/90 (1%) Frame = -2 Query: 267 CALLEVLVQNNIMSSAYSVTERAISLHMY-GIVDVLINEYSSSEVWVKLLEFVLWVYTKK 91 C +LE+L +N+++ SAY V E+ SL M + V I +Y + V LL+ +L+V KK Sbjct: 106 CVMLEILARNHMVRSAYWVVEKVTSLDMTRAVASVFIRDYVFARVSDGLLDLILFVCAKK 165 Query: 90 MMIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 +++EQCLS FD MI NG++P+V NCNRI+R Sbjct: 166 LLLEQCLSIFDDMIRNGVVPDVTNCNRIVR 195 >ref|XP_003543970.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X1 [Glycine max] gi|571497069|ref|XP_006593783.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X2 [Glycine max] gi|571497071|ref|XP_006593784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X3 [Glycine max] gi|571497073|ref|XP_006593785.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X4 [Glycine max] gi|571497075|ref|XP_006593786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X5 [Glycine max] gi|571497078|ref|XP_006593787.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X6 [Glycine max] gi|571497080|ref|XP_006593788.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X7 [Glycine max] gi|571497082|ref|XP_006593789.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X8 [Glycine max] gi|571497084|ref|XP_006593790.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X9 [Glycine max] gi|571497086|ref|XP_006593791.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X10 [Glycine max] gi|571497088|ref|XP_006593792.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X11 [Glycine max] gi|571497090|ref|XP_006593793.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X12 [Glycine max] gi|571497092|ref|XP_006593794.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X13 [Glycine max] gi|571497094|ref|XP_006593795.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X14 [Glycine max] gi|571497096|ref|XP_006593796.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X15 [Glycine max] gi|571497098|ref|XP_006593797.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X16 [Glycine max] gi|571497100|ref|XP_006593798.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X17 [Glycine max] gi|571497102|ref|XP_006593799.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X18 [Glycine max] gi|571497104|ref|XP_006593800.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like isoform X19 [Glycine max] Length = 687 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/88 (44%), Positives = 61/88 (69%), Gaps = 1/88 (1%) Frame = -2 Query: 261 LLEVLVQNNIMSSAYSVTERAISLHMY-GIVDVLINEYSSSEVWVKLLEFVLWVYTKKMM 85 +L++L +N +M SAY V E+ +S+ M G++DV+ + S +L+ +LW+Y KK + Sbjct: 87 ILDILARNGLMRSAYCVMEKVVSVKMENGVIDVVSSSEVSMPSVKLILDLLLWIYVKKSL 146 Query: 84 IEQCLSTFDKMIGNGLLPEVKNCNRILR 1 +E+CL F KM+ GLLP+VKNCNR+LR Sbjct: 147 LEKCLLVFYKMVSKGLLPDVKNCNRVLR 174 >ref|XP_003589662.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355478710|gb|AES59913.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 988 Score = 84.0 bits (206), Expect = 2e-14 Identities = 42/91 (46%), Positives = 66/91 (72%), Gaps = 3/91 (3%) Frame = -2 Query: 264 ALLEVLVQNNIMSSAYSVTERAISLHMYG-IVDVLINEYS--SSEVWVKLLEFVLWVYTK 94 A+L++L +N M AY V E+AI + + G ++DVL+ +SEV VKLL+ ++ V+ K Sbjct: 90 AILDILAKNGFMKPAYWVMEKAIEVKVDGGVLDVLVGIGCGRNSEVSVKLLDLLIQVFAK 149 Query: 93 KMMIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 K+++E+CL F KM+ NGLLP+V+NCNR+L+ Sbjct: 150 KLILEKCLMVFYKMVNNGLLPDVRNCNRVLK 180 >ref|XP_006846521.1| hypothetical protein AMTR_s00018p00185360 [Amborella trichopoda] gi|548849331|gb|ERN08196.1| hypothetical protein AMTR_s00018p00185360 [Amborella trichopoda] Length = 735 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/89 (44%), Positives = 59/89 (66%) Frame = -2 Query: 267 CALLEVLVQNNIMSSAYSVTERAISLHMYGIVDVLINEYSSSEVWVKLLEFVLWVYTKKM 88 C++L +L Q+ M SAY V E I + + + L+N + SE +KLL +L +Y +K Sbjct: 126 CSILNILAQSGRMKSAYRVIENVIQHNGDKLPEFLMNGFVCSESSIKLLNVLLLIYAQKG 185 Query: 87 MIEQCLSTFDKMIGNGLLPEVKNCNRILR 1 M+EQ ++TF M+GNG LP+V+NCNRILR Sbjct: 186 MVEQSVTTFYSMVGNGFLPDVRNCNRILR 214