BLASTX nr result
ID: Paeonia24_contig00034123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00034123 (739 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635514.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 emb|CBI38482.3| unnamed protein product [Vitis vinifera] 60 6e-07 emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] 60 6e-07 ref|XP_002510967.1| pentatricopeptide repeat-containing protein,... 57 5e-06 >ref|XP_003635514.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Vitis vinifera] Length = 347 Score = 60.5 bits (145), Expect = 6e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 1 YLLLSRGVDNGFIPNDVTWYILVSNFVKEDDDK 99 +LLLSRGVD+GFIPN+VTWYILVSNF+KE D + Sbjct: 314 HLLLSRGVDSGFIPNEVTWYILVSNFIKEGDQE 346 >ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Vitis vinifera] Length = 740 Score = 60.5 bits (145), Expect = 6e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 1 YLLLSRGVDNGFIPNDVTWYILVSNFVKEDDDK 99 +LLLSRGVD+GFIPN+VTWYILVSNF+KE D + Sbjct: 707 HLLLSRGVDSGFIPNEVTWYILVSNFIKEGDQE 739 >emb|CBI38482.3| unnamed protein product [Vitis vinifera] Length = 368 Score = 60.5 bits (145), Expect = 6e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 1 YLLLSRGVDNGFIPNDVTWYILVSNFVKEDDDK 99 +LLLSRGVD+GFIPN+VTWYILVSNF+KE D + Sbjct: 335 HLLLSRGVDSGFIPNEVTWYILVSNFIKEGDQE 367 >emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] Length = 722 Score = 60.5 bits (145), Expect = 6e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +1 Query: 1 YLLLSRGVDNGFIPNDVTWYILVSNFVKEDDDK 99 +LLLSRGVD+GFIPN+VTWYILVSNF+KE D + Sbjct: 689 HLLLSRGVDSGFIPNEVTWYILVSNFIKEGDQE 721 >ref|XP_002510967.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550082|gb|EEF51569.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 774 Score = 57.4 bits (137), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 YLLLSRGVDNGFIPNDVTWYILVSNFVKE 87 YLLL RGV+N FIPNDVTWYILVSNF+KE Sbjct: 680 YLLLLRGVENAFIPNDVTWYILVSNFIKE 708