BLASTX nr result
ID: Paeonia24_contig00034104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00034104 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510184.1| transcription factor, putative [Ricinus comm... 59 5e-07 gb|AHL29313.1| WOX4a [Populus tomentosa] 58 2e-06 ref|XP_006374903.1| homeobox-leucine zipper transcription factor... 55 8e-06 >ref|XP_002510184.1| transcription factor, putative [Ricinus communis] gi|223550885|gb|EEF52371.1| transcription factor, putative [Ricinus communis] Length = 228 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/59 (55%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = -2 Query: 322 TTSPLSTMGEVEREREVSPYKRKCRSWGF---XXXXXXXXXXXXXDKTLELFPLHPEGR 155 TT L T GEV + E SPYKRKCRSWGF D+TLELFPLHPEGR Sbjct: 170 TTISLETKGEVLEKDEDSPYKRKCRSWGFECLELEESRSSCREEGDRTLELFPLHPEGR 228 >gb|AHL29313.1| WOX4a [Populus tomentosa] Length = 213 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/58 (56%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = -2 Query: 322 TTSPLSTMGEVEREREVSPYKRKCRSWGF--XXXXXXXXXXXXXDKTLELFPLHPEGR 155 T L T GEVERE + SPYKRKCRSW F D+TLELFPLHPEGR Sbjct: 157 TIISLDTRGEVEREED-SPYKRKCRSWAFECLELEDSRSCREKGDRTLELFPLHPEGR 213 >ref|XP_006374903.1| homeobox-leucine zipper transcription factor family protein [Populus trichocarpa] gi|507480286|gb|AGM48535.1| WUSCHEL-related homeobox 4 [Populus x canadensis] gi|550323212|gb|ERP52700.1| homeobox-leucine zipper transcription factor family protein [Populus trichocarpa] Length = 213 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/58 (53%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = -2 Query: 322 TTSPLSTMGEVEREREVSPYKRKCRSWGF--XXXXXXXXXXXXXDKTLELFPLHPEGR 155 T L T GEVE++ + SPYKRKCRSW F D+TLELFPLHPEGR Sbjct: 157 TIISLDTRGEVEKDED-SPYKRKCRSWSFECFELEESRSCKEEGDRTLELFPLHPEGR 213